HiSeq10162 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10162
Unique NameHiSeq10162
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length2475
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10162HiSeq10162_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10162 ID=HiSeq10162|Name=HiSeq10162|organism=Ostrinia scapulalis|type=mRNA|length=2475bp
ACTTTGCTGCTTTGCGAAACTAATCAGGGTAAAGTTTAATAAGTAAAATG
ATAAGAAAACGGTTTACGTAAAAAATATCAAGTATATTTCAGTAAACAAC
ACAGCATAATGACTTACTCGTAATTATCTACATCAACATGTAAATAAATC
TTATTGTGTAGCTAAAAGTGAATTAAAGGATTTATTTAGATCTATAAAAT
AAATTACTTAACGCATTTACTAGGCGAATACATAATATTAGGACAAATAC
AATAAGAAGACATTATCGTTATGTATTACAGTAATTAAAATATAGACATT
TCACAGATGATACTACAAAATAACAATATTTAGCATATTTCAAAGGTTTT
TGGCCTAAGGTAGATGTAGTTTGAACGCCATTCGCTGCTTCAATTCATAT
CTAACCCATGTACAGGAGGCTTAACATTCCGATATCCAGGTTGGAGAAAG
GGCTTGCTGCAGTTGCAGCTGATCTAGCTCTTCTTGTGTCACGAATGTTC
CCTGCACCATAAACACTTTGCAGATACTGGTAGACCGCTGGCAAGTTCCA
AGCACCTCTCGCTAGCCTACACTCGGGACATCTAGTTACACTTGGAAACT
GAATCTTTGGATACTCTGGATCCTCCGTCACATCACCGGCAAGTCTTAAA
TTCACTTCATTATGTGATATCCATAACCATAGCACAGCTTTGTCATTTTC
TTTTACATCAAATAATCTGTTTCGAGCAGCCATAGCCTGAAAGTGTTCTG
AACAAGTAGTGCATCCAAAAAAGTGTTTTACGTAACCATGCATCACTCTT
AAAACTCTTGGCCCTTCGTTGCCAGGCTTAAGTGCAGCATTAACAGTCAG
TGTGTGAAATAGGGTCCATAAGCCACAGGTATAACCTCGATATTTTGACT
GACTTCCCTTGCATCCGATATATTCTAATTGTGACATGTAGACTGGTGCA
TGGACAGTTTCTAATCGCTTCACAATTTCGTAAATATCATTTCCATTCCA
CTCACTTCTGGTACGAAGTGTATCATGTATATTTTCAATATATTCTTTGA
GATTGTTGTTTTTGAATGGGAATAAGGTTTTCAGGACATATAAGTAATCT
AAAAGAACAGTCAAAGGTTCTCCTGTTAGGCTTTTATATCTTGTAATTTC
AGTATTTAAACTTGTTTTCAGTGTCTTTTCTAGGTCACTGTAGTATACAG
CATCGGAGTGAGTTGAAGTTAATTTCTCATCTGAGTGATCATTATGAATC
ATTTCCAGCTCAGGTGTGTCACGTGTGGGGAAAACATAATTTTTCGACTT
CAAAAATGTGTTCACAGCTGCCAATAGATTTTGCTTAGTTGGATTTTTTG
GAGTAAGCGAATTAGCATCCAACATGGAACTTACAGCAACAAGGCCCGGA
AAGTGGCTGACACCTGCTGTGTTTGCCAACTCACTAGTATCAAAAACTCT
TTTTACTTTTATGTGGTTATAATCATTTATATCCAATGCAAGTTCTGATC
CAACAGTTGAGTTTTCATTTTCAAATACTAAAAATGTATAGATTACATCA
TTTGGAACATCATCAAGAACTGAAGCATAAGAAGCATATGATGCAATAGA
CAATTTGGGCGCAAATCTCATCCTGCCCAGAGTCTGTTCCTGCTGCAATT
TGGTGATTATTTGAGCCTTCAGTTTTTCTGCAGTGTCAGTCATTTGAATA
CGATCACCCACATTGTGGTTTGCTTTCACATAATGCTCATGAATGTAACG
TAATGAAGGGTAGGCCATGACTTCAAACTCTCTGCATATCTCATTGTTTT
CCTCAATGGAACAGTCCATAACTTTAAGCTGAATTAAATTTTTCCATGGA
CCCACTTCAGCTGCTAGAGCCTTAAATTTTGGGGCAAATCCTCTGCAATG
ACCGCAGTAGCTGTTATAAAATTGAACGATTGCTGCATGGTTTTGGCTAT
ACACCTTCTTCTCAAAATTTCGCTGCGTTAAGATAATAACATGATCTGAC
TTACTATATAAACCTTGCTCATCAACATCACCGTCGTTTGCAATCACAGC
ACAATTTACTATAGAAGGAACTAGTACAATCGCGATTATACTCCAAAGAT
TCATGGTCGTTGACAATTACATCCAAATAAAACCTTGTCCAAATCTTACA
CAGCACCACAAAGACGACCGCCGTACGAGCGACGACTAACAACGACTAGC
ATTGAAAGGAATTATTGGATTACTAGGTATATCCAATAGCGATAAAACTG
CATACGTCATAGATTCAATGAAACATTTTACTTCTTGGACAAATTCTCAT
AACTTTCGTTGATTACACTACGAGTAGTTACTACTTTTTTATTCCTAGTG
CCTGCAGAACGTAACGCAACGTCACTTTTAATGATTTCTATTGGTTCAAC
AATGGTTTATAAATTTATTTTGACCAATTAAAATTAAAAGAACATTTGGT
AACAAAACATTTGAGCGACTTATGC
back to top

protein sequence of HiSeq10162

>HiSeq10162_p ID=HiSeq10162_p|Name=HiSeq10162|organism=Ostrinia scapulalis|type=polypeptide|length=567bp
MNLWSIIAIVLVPSIVNCAVIANDGDVDEQGLYSKSDHVIILTQRNFEKK
VYSQNHAAIVQFYNSYCGHCRGFAPKFKALAAEVGPWKNLIQLKVMDCSI
EENNEICREFEVMAYPSLRYIHEHYVKANHNVGDRIQMTDTAEKLKAQII
TKLQQEQTLGRMRFAPKLSIASYASYASVLDDVPNDVIYTFLVFENENST
VGSELALDINDYNHIKVKRVFDTSELANTAGVSHFPGLVAVSSMLDANSL
TPKNPTKQNLLAAVNTFLKSKNYVFPTRDTPELEMIHNDHSDEKLTSTHS
DAVYYSDLEKTLKTSLNTEITRYKSLTGEPLTVLLDYLYVLKTLFPFKNN
NLKEYIENIHDTLRTRSEWNGNDIYEIVKRLETVHAPVYMSQLEYIGCKG
SQSKYRGYTCGLWTLFHTLTVNAALKPGNEGPRVLRVMHGYVKHFFGCTT
CSEHFQAMAARNRLFDVKENDKAVLWLWISHNEVNLRLAGDVTEDPEYPK
IQFPSVTRCPECRLARGAWNLPAVYQYLQSVYGAGNIRDTRRARSAATAA
SPFSNLDIGMLSLLYMG
back to top