HiSeq10163 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10163
Unique NameHiSeq10163
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length2522
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10163HiSeq10163_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10163 ID=HiSeq10163|Name=HiSeq10163|organism=Ostrinia scapulalis|type=mRNA|length=2522bp
ACTTTGCTGCTTTGCGAAACTAATCAGGGTAAAGTTTAATAAGTAAAATG
ATAAGAAAACGGTTTACGTAAAAAATATCAAGTATATTTCAGTAAACAAC
ACAGCATAATGACTTACTCGTAATTATCTACATCAACATGTAAATAAATC
TTATTGTGTAGCTAAAAGTGAATTAAAGGATTTATTTAGATCTATAAAAT
AAATTACTTAACGCATTTACTAGGCGAATACATAATATTAGGACAAATAC
AATAAGAAGACATTATCGTTATGTATTACAGTAATTAAAATATAGACATT
TCACAGATGATACTACAAAATAACAATATTTAGCATATTTCAAAGGTTTT
TGGCCTAAGGTAGATGTAGTTTGAACGCCATTCGCTGCTTCAATTCATAT
CTAACCCATGTACCTTAGCCTAAACTGGTAGCACTTCCCGCCCAGATGCG
TAGGAGCAAAAGGAGGCTTAACATTCCGATATCCAGGTTGGAGAAAGGGC
TTGCTGCAGTTGCAGCTGATCTAGCTCTTCTTGTGTCACGAATGTTCCCT
GCACCATAAACACTTTGCAGATACTGGTAGACCGCTGGCAAGTTCCAAGC
ACCTCTCGCTAGCCTACACTCGGGACATCTAGTTACACTTGGAAACTGAA
TCTTTGGATACTCTGGATCCTCCGTCACATCACCGGCAAGTCTTAAATTC
ACTTCATTATGTGATATCCATAACCATAGCACAGCTTTGTCATTTTCTTT
TACATCAAATAATCTGTTTCGAGCAGCCATAGCCTGAAAGTGTTCTGAAC
AAGTAGTGCATCCAAAAAAGTGTTTTACGTAACCATGCATCACTCTTAAA
ACTCTTGGCCCTTCGTTGCCAGGCTTAAGTGCAGCATTAACAGTCAGTGT
GTGAAATAGGGTCCATAAGCCACAGGTATAACCTCGATATTTTGACTGAC
TTCCCTTGCATCCGATATATTCTAATTGTGACATGTAGACTGGTGCATGG
ACAGTTTCTAATCGCTTCACAATTTCGTAAATATCATTTCCATTCCACTC
ACTTCTGGTACGAAGTGTATCATGTATATTTTCAATATATTCTTTGAGAT
TGTTGTTTTTGAATGGGAATAAGGTTTTCAGGACATATAAGTAATCTAAA
AGAACAGTCAAAGGTTCTCCTGTTAGGCTTTTATATCTTGTAATTTCAGT
ATTTAAACTTGTTTTCAGTGTCTTTTCTAGGTCACTGTAGTATACAGCAT
CGGAGTGAGTTGAAGTTAATTTCTCATCTGAGTGATCATTATGAATCATT
TCCAGCTCAGGTGTGTCACGTGTGGGGAAAACATAATTTTTCGACTTCAA
AAATGTGTTCACAGCTGCCAATAGATTTTGCTTAGTTGGATTTTTTGGAG
TAAGCGAATTAGCATCCAACATGGAACTTACAGCAACAAGGCCCGGAAAG
TGGCTGACACCTGCTGTGTTTGCCAACTCACTAGTATCAAAAACTCTTTT
TACTTTTATGTGGTTATAATCATTTATATCCAATGCAAGTTCTGATCCAA
CAGTTGAGTTTTCATTTTCAAATACTAAAAATGTATAGATTACATCATTT
GGAACATCATCAAGAACTGAAGCATAAGAAGCATATGATGCAATAGACAA
TTTGGGCGCAAATCTCATCCTGCCCAGAGTCTGTTCCTGCTGCAATTTGG
TGATTATTTGAGCCTTCAGTTTTTCTGCAGTGTCAGTCATTTGAATACGA
TCACCCACATTGTGGTTTGCTTTCACATAATGCTCATGAATGTAACGTAA
TGAAGGGTAGGCCATGACTTCAAACTCTCTGCATATCTCATTGTTTTCCT
CAATGGAACAGTCCATAACTTTAAGCTGAATTAAATTTTTCCATGGACCC
ACTTCAGCTGCTAGAGCCTTAAATTTTGGGGCAAATCCTCTGCAATGACC
GCAGTAGCTGTTATAAAATTGAACGATTGCTGCATGGTTTTGGCTATACA
CCTTCTTCTCAAAATTTCGCTGCGTTAAGATAATAACATGATCTGACTTA
CTATATAAACCTTGCTCATCAACATCACCGTCGTTTGCAATCACAGCACA
ATTTACTATAGAAGGAACTAGTACAATCGCGATTATACTCCAAAGATTCA
TGGTCGTTGACAATTACATCCAAATAAAACCTTGTCCAAATCTTACACAG
CACCACAAAGACGACCGCCGTACGAGCGACGACTAACAACGACTAGCATT
GAAAGGAATTATTGGATTACTAGGTATATCCAATAGCGATAAAACTGCAT
ACGTCATAGATTCAATGAAACATTTTACTTCTTGGACAAATTCTCATAAC
TTTCGTTGATTACACTACGAGTAGTTACTACTTTTTTATTCCTAGTGCCT
GCAGAACGTAACGCAACGTCACTTTTAATGATTTCTATTGGTTCAACAAT
GGTTTATAAATTTATTTTGACCAATTAAAATTAAAAGAACATTTGGTAAC
AAAACATTTGAGCGACTTATGC
back to top

protein sequence of HiSeq10163

>HiSeq10163_p ID=HiSeq10163_p|Name=HiSeq10163|organism=Ostrinia scapulalis|type=polypeptide|length=578bp
MNLWSIIAIVLVPSIVNCAVIANDGDVDEQGLYSKSDHVIILTQRNFEKK
VYSQNHAAIVQFYNSYCGHCRGFAPKFKALAAEVGPWKNLIQLKVMDCSI
EENNEICREFEVMAYPSLRYIHEHYVKANHNVGDRIQMTDTAEKLKAQII
TKLQQEQTLGRMRFAPKLSIASYASYASVLDDVPNDVIYTFLVFENENST
VGSELALDINDYNHIKVKRVFDTSELANTAGVSHFPGLVAVSSMLDANSL
TPKNPTKQNLLAAVNTFLKSKNYVFPTRDTPELEMIHNDHSDEKLTSTHS
DAVYYSDLEKTLKTSLNTEITRYKSLTGEPLTVLLDYLYVLKTLFPFKNN
NLKEYIENIHDTLRTRSEWNGNDIYEIVKRLETVHAPVYMSQLEYIGCKG
SQSKYRGYTCGLWTLFHTLTVNAALKPGNEGPRVLRVMHGYVKHFFGCTT
CSEHFQAMAARNRLFDVKENDKAVLWLWISHNEVNLRLAGDVTEDPEYPK
IQFPSVTRCPECRLARGAWNLPAVYQYLQSVYGAGNIRDTRRARSAATAA
SPFSNLDIGMLSLLLLLRIWAGSATSLG
back to top