HiSeq10167 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10167
Unique NameHiSeq10167
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length1222
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10167HiSeq10167_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10167 ID=HiSeq10167|Name=HiSeq10167|organism=Ostrinia scapulalis|type=mRNA|length=1222bp
AGTCATATAATAACATAATATCAGTGTAGATTGTGGATGTATGTAGTTAG
TCTACTTAGATGCTCAGTCTACAAACTATATTACCTAAACAAAATTAGAA
AGCTTGAGAGTTACAGCATGAAAGATGCTAGAGATTAAAAAGTTGTCATC
AAATAATTATGCTGATTTGCTGTGAAGTGGGTATCTAAATCTATGGACCA
ATTTTGACCCAGTGAGAGTCTCAGTGATGAAAACGTATTAAATACATAAA
TTTACGGAATTTTTTCAAAACAAAATTATTGTATAAATTATTTATTATCA
CATAACTCCCTGGGGGATTTCCATTTTACTTAGTCTTAATATAAAATCTA
ATAGGTACATCTGGACTTTAACTTCAATAGGTTTATTTGTAACAAAAAAT
CCGGGAACTCCAGCTTTTTCTAATGTCACTTGTTGATCACTAACTTTTTG
ATCAAGTTGGATAACTAATTTCATGTCTGTCTGTTTAAGTTCCTCTCTAT
GTCGCCTTTGTAATATGGTTTTCTGCAATTCCTGATGTTCAGGACTTGTT
GAAGTATTAATCATATTCTGAATTTCCAAGGTATGTTTGTTGATTATTTG
CAGTCTTTGTTGAAATAAATGTTTTTCAGTAACATGTTGAATTTCCATTA
GGCCTTTGACTATTTCAAATACTGTTTCATTCAGGAGGCAATTAGCTAGA
CCCGACAGAAGCTCGATTGGAACTCTCATTTGGTATTTCGGTGGTAATTC
TCGAGCCATGTCTTGAAGTTGTTCTAATAAGAAATATAGTTTTCTTTGTA
GAGCTTCAGGTGTAGGCTCAATATCCATTTTATTATTGAACAAAATCCTT
TTATTGTAAGATTGTGAAGTTATTACTTAATCTATTAACATATTGAAACG
AACGCAATTATTTTGTTTAGAACACAGCGGTGTAATAATCACAATTCACA
TTTTATCGTAAATTAAAAAACAAATACTACAAATTCGTGTCAATTTTCAT
TTCTCAAATTTGATTGACAACTTTATTTTAACTTTTGTTCAATGTCCATT
GTTCCAGATTAAATATTTAAAGTGTTTTATTAGGAAGGAAAGGACATAGA
GAGCTAAAAGTTCTTCGCTTGACATGTTTGACCATTACCATGATACGATA
ACCATAATTTTTTGCTTGGTTAGCGATTATTACTGCTACTTGTGGCAAAA
GTGAGACAGCACAATAACAATG
back to top

protein sequence of HiSeq10167

>HiSeq10167_p ID=HiSeq10167_p|Name=HiSeq10167|organism=Ostrinia scapulalis|type=polypeptide|length=176bp
MDIEPTPEALQRKLYFLLEQLQDMARELPPKYQMRVPIELLSGLANCLLN
ETVFEIVKGLMEIQHVTEKHLFQQRLQIINKHTLEIQNMINTSTSPEHQE
LQKTILQRRHREELKQTDMKLVIQLDQKVSDQQVTLEKAGVPGFFVTNKP
IEVKVQMYLLDFILRLSKMEIPQGVM
back to top