HiSeq10168 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10168
Unique NameHiSeq10168
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length1303
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10168HiSeq10168_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10168 ID=HiSeq10168|Name=HiSeq10168|organism=Ostrinia scapulalis|type=mRNA|length=1303bp
AGTCATATAATAACATAATATCAGTGTAGATTGTGGATGTATGTAGTTAG
TCTACTTAGATGCTCAGTCTACAAACTATATTACCTAAACAAAATTAGAA
AGCTTGAGAGTTACAGCATGAAAGATGCTAGAGATTAAAAAGTTGTCATC
AAATAATTATGCTGATTTGCTGTGAAGTGGGTATCTAAATCTATGGACCA
ATTTTGACCCAGTGAGAGTCTCAGTGATGAAAACGTATTAAATACATAAA
TTTACGGAATTTTTTCAAAACAAAATTATTGTATAAATTATTTATTATCA
CATAACTCCCTGGGGGATTTCCATTTTACTTAGTCTTAATATAAAATCTA
ATAGGTACATCTGGACTTTAACTTCAATAGGTTTATTTGTAACAAAAAAT
CCGGGAACTCCAGCTTTTTCTAATGTCACTTGTTGATCACTAACCTGTAA
TGCAAAAGAAAAAGTTTTAATCATTTTGGGTCAAATAATACAGATATAAT
ATAGATATTTAATACTTCCACATACTTTTTGATCAAGTTGGATAACTAAT
TTCATGTCTGTCTGTTTAAGTTCCTCTCTATGTCGCCTTTGTAATATGGT
TTTCTGCAATTCCTGATGTTCAGGACTTGTTGAAGTATTAATCATATTCT
GAATTTCCAAGGTATGTTTGTTGATTATTTGCAGTCTTTGTTGAAATAAA
TGTTTTTCAGTAACATGTTGAATTTCCATTAGGCCTTTGACTATTTCAAA
TACTGTTTCATTCAGGAGGCAATTAGCTAGACCCGACAGAAGCTCGATTG
GAACTCTCATTTGGTATTTCGGTGGTAATTCTCGAGCCATGTCTTGAAGT
TGTTCTAATAAGAAATATAGTTTTCTTTGTAGAGCTTCAGGTGTAGGCTC
AATATCCATTTTATTATTGAACAAAATCCTTTTATTGTAAGATTGTGAAG
TTATTACTTAATCTATTAACATATTGAAACGAACGCAATTATTTTGTTTA
GAACACAGCGGTGTAATAATCACAATTCACATTTTATCGTAAATTAAAAA
ACAAATACTACAAATTCGTGTCAATTTTCATTTCTCAAATTTGATTGACA
ACTTTATTTTAACTTTTGTTCAATGTCCATTGTTCCAGATTAAATATTTA
AAGTGTTTTATTAGGAAGGAAAGGACATAGAGAGCTAAAAGTTCTTCGCT
TGACATGTTTGACCATTACCATGATACGATAACCATAATTTTTTGCTTGG
TTAGCGATTATTACTGCTACTTGTGGCAAAAGTGAGACAGCACAATAACA
ATG
back to top

protein sequence of HiSeq10168

>HiSeq10168_p ID=HiSeq10168_p|Name=HiSeq10168|organism=Ostrinia scapulalis|type=polypeptide|length=204bp
MDIEPTPEALQRKLYFLLEQLQDMARELPPKYQMRVPIELLSGLANCLLN
ETVFEIVKGLMEIQHVTEKHLFQQRLQIINKHTLEIQNMINTSTSPEHQE
LQKTILQRRHREELKQTDMKLVIQLDQKVCGSIKYLYYICIIXXPKMIKT
FSFALQVSDQQVTLEKAGVPGFFVTNKPIEVKVQMYLLDFILRLSKMEIP
QGVM
back to top