HiSeq10171 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10171
Unique NameHiSeq10171
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length743
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10171HiSeq10171_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10171 ID=HiSeq10171|Name=HiSeq10171|organism=Ostrinia scapulalis|type=mRNA|length=743bp
CTAACGATACCAGCCCTAACACCGCCACTACAGACAAGATGGCGAACAGA
AAACTTTGTGCGCTCGTGGTGGTGTTAGGGCTGGTATCGTTAGTTTATGG
AATCATGAGCGATTGTGAACTACCGAAAGATAAAGGGTCATGTGATGGGC
GGTATCGGAGCTACTATTTCGACATGAATAGCCGGGAATGCAGGCGATTC
ATTTGGTCAGGCTGCGGAGGCAACGGCAACAAATTCTTCACCCTGGATGA
GTGCCAGTTCGCTTGCCACTACTACATGCGCCTCAAACCGTAACTGCCAA
CACAACGAGCTTGCTAAGCACTATTAGCCTGTTGCTATTTTGTCATTGTT
TTAGATGATTCTCGGACAGACGTATTGACATTATTGATTTCATGAGTAAA
GTATCTTTTGATTATGTGCATTTTCATTATAAAATAGCTCTGACTCCTTT
ACTCGCCTAATATCCTAATAATAAAATTATTAAAGTTTCCCAGCAAAAGA
CTATGATAATTTACGAATAGGTATAAGAAATAATATTACACTCATTAAAC
CATAACATTTCGTGAAACTACAAACCAAGAAAGTATTATTATTGTAATGA
CTAATAAAGGGACTATTGAGAACCCTACATAACCCTAACAATGCCAACAA
TCCGAAATTCTACCAAAAACTATACAATATATAAAGTAAAAATTCAAATT
AAATAGATTTTAGAATTACTATTTATAGCCTGACCAGGAACAT
back to top

protein sequence of HiSeq10171

>HiSeq10171_p ID=HiSeq10171_p|Name=HiSeq10171|organism=Ostrinia scapulalis|type=polypeptide|length=96bp
NDTSPNTATTDKMANRKLCALVVVLGLVSLVYGIMSDCELPKDKGSCDGR
YRSYYFDMNSRECRRFIWSGCGGNGNKFFTLDECQFACHYYMRLKP
back to top