HiSeq10174 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq10174
Unique NameHiSeq10174
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length1919
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq10174HiSeq10174_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq10174 ID=HiSeq10174|Name=HiSeq10174|organism=Ostrinia scapulalis|type=mRNA|length=1919bp
GCAATTTCGCTCCATAGTGCGGCGTCGACTACGATTGAAATGAAAGCTTC
TCTTTGATTAAATCTATTATTATTATTCATCAAAAAAATTGTGCAATCTA
GGCAACCTTGAATGGCACCAAAAATTGAATTCACAAAAGAAAATAAATAT
GTACTGGTAACCAAGTCAAGCAACCTAGATTTAATGGGTACAGATTTCGA
ATACATATTAATATATACAGATTTTGGCTAATTCCATATCTGGAATGTTG
TACAAGTACATAAAGTATGAATTAAGTCTAAGTCTACACATAATTTCACA
AATATTAAATTTATAATTATAACCTTATGTACATTTAACTTTGTTTGAAT
CTCATTAGTATATTTTATGATACATCTGCATTTTGAACCACATTCCTATA
TTACACTCATTCTTCATTCAGTAGTGAGATACAGAATAAATGTTTTCAAA
CACTCCACACAATTATCAGTCTCAATGTCCTTAAGTACCTACACAGCTAA
AATTTGGCAAATATAAGAGCTCAATCCTGTATCTTGATGTCACTTTTTGT
AACATTCTGGTTCATCTGATCATTTTCATATTCCACAAAATCATCAAAAA
GGCTTGGCCAAGCCTCGGTGTCATCATAAGTGCCAAGATCTTCTCCAACA
AACTCACTAAAGTTTAAAAACATATACCAAGTGTCTTTGGGAATGCCTCG
GATGTGAGTATTTTTCTCCAGATAACTCAGCCACTTATCTAATACTGGTG
GTTCATTGTTTGTGAAGACTAGACGCCACAAGAGTACTGCTATATCTGTC
GGCAGTATTCTTTGACCAGTACTTACATCTAAACCAAATTTAAATGTGAA
TCTATACAAATCTTTAAAACTTTCAGAATCTCTATTTAATCCACAAGTAA
TTTCATTCAACTTGAGCTGAATACCTTTAATAGAATCAGTTTTCATGTTT
TTAAGGCCTTGTACAAACTCTGATTTTGTGAATCTGCACATTTGACTAGC
ATTTAACTTCCATGCAAGCACCAAAACTTTGAAATCATCAGGGTTCAGTT
GTAAATCATTGCAAAGATTCTCTATTCCTTCTGCTAAAATAGCATCTTCT
AATGAATCTTTATATTGGTCAAATAGTTGATTAATTTTATATTCAGAAAT
TCGTGGTTCACTTGTTCCTAATGATGACATAGTTCGAGGTATTGATGGCA
ATTTTTGATAGAATGTTTTTTGCGACTTGTCAGGACAATACTGAGTTTTT
TGAGGATGTACTTCTGGGCAGGGTTCCCCTACCGAAGCCAAAGTATTAGC
ATTCTGCAAATTAGTGTTGTTCCTGTAAATTATGCTGTTCTCATTATTAT
GAAGAAGTGGTTCTTCCTGAGGATAGTCCGATACCATGACAGCAGGCACT
TGATGGGTAGTGACAATTTCTGTCATCTCATCTTTATTTCTTTGAGATGT
ACTGTTATCAGCATTGGCTTGATTTTTGAAACAACTTAGACAATGGCCCA
TTGGACAAAATGTTTATGGCAATAGTCACAGGCATACAATTAATAACACA
AAGATGATAACTCCAGTCGATCTTATTCAATTCTTTAAAATATGTACTAT
AAAACATAATGGTAAGACAGAGAGTTTTGTATAAGCTCCTTCAATAACTT
TGTCATGAAATCTACCTGAATTCATTCCCTTTACAACTTTATTAAGATCA
TAATAGCATTGCTTATGTTGATATTCAAAGCTTGCAGTAAATATGGAAAA
GAGTGTATAAATGTTTTTCGATAGCAAGGATTGAACGTACAAATACTTTT
ACTACTAATTCACTATTTTTCACGAAAATATAGACCAAAGAGTAAAATGA
CTGACAGTTCTCTTTTTTTGACATCAAACAGACAGTAGAACTGTCAATCA
TTTTTTTTTCATTCCAAAG
back to top

protein sequence of HiSeq10174

>HiSeq10174_p ID=HiSeq10174_p|Name=HiSeq10174|organism=Ostrinia scapulalis|type=polypeptide|length=219bp
MSSLGTSEPRISEYKINQLFDQYKDSLEDAILAEGIENLCNDLQLNPDDF
KVLVLAWKLNASQMCRFTKSEFVQGLKNMKTDSIKGIQLKLNEITCGLNR
DSESFKDLYRFTFKFGLDVSTGQRILPTDIAVLLWRLVFTNNEPPVLDKW
LSYLEKNTHIRGIPKDTWYMFLNFSEFVGEDLGTYDDTEAWPSLFDDFVE
YENDQMNQNVTKSDIKIQD
back to top