HiSeq31013 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq31013
Unique NameHiSeq31013
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length2750
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq31013HiSeq31013_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq31013 ID=HiSeq31013|Name=HiSeq31013|organism=Ostrinia scapulalis|type=mRNA|length=2750bp
CCCAGTCCCTTCCGGTTCTATTTTTAAAATTTATTTTTCCTTCTCATTTT
CTTTCATTTGTTTTAATTTGTTCGTAATTAATTTTGTAGTGACCACTGAA
TAAAATGGTGAACGCAAGTTTAGCATACGAAATTCTACTTTACATAAATT
CGTTTTATTTCGGTCTATTCGCAACATGTGAACTAGGAACGCTGATCCTG
AAATCCGTATTGATTATAGAGAAGTATGGAGTCGACAAGGATCCAACCAA
ACTAGGCCAAGATTACGGTGTTTTATTGGGTTTGTTTGTGATCGAGGCGA
TCAGATTAATATTAGGCAGAAAGGGCAGTCTCAGTGAGAGAGATGTGCCA
GTGATGTTCTCGGTGCTGCTAACAGTTCCCTCTATGATTGGTGTTCTGTA
TCTGCTCATCTGGCAAGTCGTGGTGCTAAGGATCGAATACATCTGGTGCA
CACTGATGTTGTCCTTGCAAATGCTAGAGTTTATGTTTGCGGCTATGTTT
ATTGTCACTATGTGTAAAGGCCCGACATACGACTAATTTTAATTTAGTCA
AGGCATTTTATAAACAATGTTTTTTCAATTTGAACTCATTCGCCAAAGAT
TTGTAATAAGTACAAGATGCCAACATCCTCTTATACTATTATGTTTACCT
ATAACTATTTTACTATTTGAAGTTGCTAGTCATGGATAATTAAAATATTT
TCATAAAGGTAATAATATTTAACTACAAGATTATTAGCATTTTTGAATTA
CCTACAACTATTTTTATACAGACAGAAAGTATGTACTTACTAAAATGTAT
GATGTAAAATTTTATTTATGAAAGTTTAGATACCTACCAAAGATTTTAGT
TTAGTTAGATGTGTGTTGACACTACACAACACAAGCCAGTATTTTATCAC
AGAGTGAGTGTTGTAGGTTGTAGCACAAATATTATTTGTGTTGTGTGTAA
TATTTTGAAGCAGTTTTTCTGCAATTTAGATGTTTGTCTGTGACAGTTCT
ATTTATTAGTCTTTCCCATGATAACTAATGTACTTTAATGTTTTGGAAAG
AGTATATTTCCCACTTATTATTATTAAGACCATAAATTCAGCCCTATATG
TAACAAAAGTGATAATGTGGCCTTTTATAGATATGTATAGTGTTTATTAT
CAAAGTAAATCTTCCATTGTATTGTAGAAGATCTTATTGATACCAAGTTT
GATGTTTGAAATGTTAAAATTGTTGTGCTTTACTATTATAGATATGCAAT
TTTTATAATACTTACTTAATATTATTGAACATGCAACATAAATACATAAA
ATTAATATTTACCAAAGAATAATCCAAGTTGTGATATTTATTCATTTTTA
TTATCTATATTCAAGTCCATAAAAATAAATGATTATGTAAATTACATACT
TAAATAAATAATTTATTTATAACTATTTCTTAGAACAGATATACATTTAT
GGATTGCAGTGTATTTGAATCACATTAAAATTACTTTACAAAATCATTGT
TATTTTCAATGTCTATTCTTTTCTGTATTCTGTTTGTAGGTAAAGAGGCA
TGCGCCCCTTGGCCATTTTATCTCTTTTGTGAACCCTGAGTTCATGTCTC
ATAAGAGCTTTTCTTGTGCCATATTTGTTACCACACATCCTGCAGCCAAA
GTCTTTGATGCCTGCATGATCAGACTTAAAATGGACATCCATATCTTTCT
GTGTATAAAAACCCCTCCGGCACTCCACACATTTGAATGGTCTATCTTTT
TTATGGGTCAGCAAATGCCTATTCAAATTGCTCCTGGTCAGAAACCGTAG
CTGGCACTTATCACACGAAAATGGCTTGTCCCCAGTATGAGTTCTCATAT
GAATTTTTAGGGATTCCATGAATCGTCCCCTGTATGGACATATTTGGCAC
TGGTATGGCAGTTCAAAGCTATGCAGCTGCATGTGCCTGACAAGATTGTC
TTTTCGATACAACTTTCCACACACATCACAAATGAGGTGTGAAGCTGACT
CATGTCTTGTTAAATGCTTCTTGTAAAGCTGAGGTGTCAGTAATCCAAAA
CAAATTGGGCATTGGATTCGCACATTTCTGTGTTGCTTGGAACTTTTATG
AGCCAGATATTCCTTGTGGGAATCGAAGTTTAACTTGCAAACTTTACATT
TGTAAGATGTAAGTTTTTTTGTTGTAGATTCAGAATAGTCATTGTTATCA
GTTTCACTGAATGTTTCTGGTTCTAATTCGTCTATAGGGTCAGCTTGAAT
AGGAGCTTGATTTAGAAGTATTGCTTCAGTTTCTTTAGCCGACTTTCGGA
ATAAAATTGCACCTTGTAGAAGAGAGTGGCAGGCGTCGCATAAGTATTTC
GGATACTCGTCACCTTCGCTTAATTCGATGTCTCCAAAAGATCTTACTGC
TTCTGATAAATCTGCTGCACTGTCCTTAGCGTAAATAGGCACAGAACCAT
CCTTCAAACATATTCTGCATGTTATTTTAGTGGAGTTCGTGGAGTCTAAA
AAATTGTTTAGGTCTACTTCAGTTTCACGTTTTTGAACACGTTTTTTCTG
TCGTTTTCTTCGCAGAATTTTCAAAAAGAAGTACGACGTGGCCATGTTTT
CATTCGACAAGTTTAAATTAAATTCAAACTTAAAATACGTGTTTTAACCG
TGCCGATATTTCCTGAAATTAAGAAGAAAGAAACAAAATCAAAACATTAC
TTCAATTGTTTTTTTTTCTGCAGACTCCGGTTGTCAAAGTCAATCTTTTA
back to top

protein sequence of HiSeq31013

>HiSeq31013_p ID=HiSeq31013_p|Name=HiSeq31013|organism=Ostrinia scapulalis|type=polypeptide|length=360bp
MATSYFFLKILRRKRQKKRVQKRETEVDLNNFLDSTNSTKITCRICLKDG
SVPIYAKDSAADLSEAVRSFGDIELSEGDEYPKYLCDACHSLLQGAILFR
KSAKETEAILLNQAPIQADPIDELEPETFSETDNNDYSESTTKKLTSYKC
KVCKLNFDSHKEYLAHKSSKQHRNVRIQCPICFGLLTPQLYKKHLTRHES
ASHLICDVCGKLYRKDNLVRHMQLHSFELPYQCQICPYRGRFMESLKIHM
RTHTGDKPFSCDKCQLRFLTRSNLNRHLLTHKKDRPFKCVECRRGFYTQK
DMDVHFKSDHAGIKDFGCRMCGNKYGTRKALMRHELRVHKRDKMAKGRMP
LYLQTEYRKE
back to top