HiSeq37 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq37
Unique NameHiSeq37
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length222
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq37HiSeq37_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq37 ID=HiSeq37|Name=HiSeq37|organism=Ostrinia scapulalis|type=mRNA|length=222bp
AGGCAACTCTTTCAGCTCAGACATCATCGCAGCTGTGTTCACGTGGTCAG
CCGGTACGAGTTTATCATCAAAGCAGCTGATCGGAGACTTGACAATTACG
TTGAATCTGAGCACGTTCACTTGGTCATCATCAGGCAAGGCATTGAGCAG
CGTCTGGGTGAACCATTCAGCCGTGACTTGGTTGGACGAGTTGTCCATCG
AGCCCGAAGCGTCGAGGAGTAT
back to top

protein sequence of HiSeq37

>HiSeq37_p ID=HiSeq37_p|Name=HiSeq37|organism=Ostrinia scapulalis|type=polypeptide|length=66bp
MDNSSNQVTAEWFTQTLLNALPDDDQVNVLRFNVIVKSPISCFDDKLVPA
DHVNTAAMMSELKELP
back to top