HiSeq41 (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameHiSeq41
Unique NameHiSeq41
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length245
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
HiSeq41HiSeq41_pOstrinia scapulalispolypeptide?


Sequences
The following sequences are available for this feature:

mRNA sequence

>HiSeq41 ID=HiSeq41|Name=HiSeq41|organism=Ostrinia scapulalis|type=mRNA|length=245bp
CGTACGAGCTGACGAGAGGAGCGTGGTGCGCGTGGGAACTCAGCAGTGGA
GCATGATGAAGACTGTGGGAGCTCAATACTGGAGCGTGATGAAGACTGTG
GGAACTCAACAGTGGAGCAGAATTGAGGCTGTGGGAGCTCAATACTGGGG
CAGAATGAAGACTGTGCGAGCTCAATAGTGGAGCAGAATGAAGACTGTGA
GAGCTCAATAGCGGAGCAGAATGAAGACTGTGAGAGCTCAATAGC
back to top

protein sequence of HiSeq41

>HiSeq41_p ID=HiSeq41_p|Name=HiSeq41|organism=Ostrinia scapulalis|type=polypeptide|length=58bp
VRADERSVVRVGTQQWSMMKTVGAQYWSVMKTVGTQQWSRIEAVGAQYWG
RMKTVRAQ
back to top