OSCA006349-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA006349-RA
Unique NameOSCA006349-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length417
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_2002contignewscf_2002:18941..22569 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.42
QI0|0|0|0.66|1|1|3|0|138
AED0.33
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA006349OSCA006349Ostrinia scapulalisgenenewscf_2002 18941..22569 +


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA006349-RAOSCA006349-PAOstrinia scapulalispolypeptidenewscf_2002 18941..22569 +


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA006349-RA:exon:778OSCA006349-RA:exon:778Ostrinia scapulalisexonnewscf_2002 18941..19037 +
OSCA006349-RA:exon:779OSCA006349-RA:exon:779Ostrinia scapulalisexonnewscf_2002 22204..22420 +
OSCA006349-RA:exon:780OSCA006349-RA:exon:780Ostrinia scapulalisexonnewscf_2002 22467..22569 +


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA006349-RA:cdsOSCA006349-RA:cdsOstrinia scapulalisCDSnewscf_2002 22467..22569 +


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA006349-RA ID=OSCA006349-RA|Name=OSCA006349-RA|organism=Ostrinia scapulalis|type=mRNA|length=417bp
ATGGGCAGCGTGACATTAACGATGGTGAGAAATGTTAAGAAGGGTGGCAT
AGATAATTACTATGGGGGCCTCCCCCACCACGACCTAATGTTAATTCAGT
TGGAGGAGAGTCTTATGTTCGGTGTTTCTTTACGAGATCGAATCAGAAAT
GAGGAGATCCGTGAGCGAGCTAAAGTCGCTGATATAGCCCAACGGATCAG
CAAACTGAAGTGGCAATGGACAGGGCACATACTCGTAAGTAGTATGCAGA
CTGACGGCCGATGGGGCAACAAGGTTCTGGAGTGGAGGCGCAGCGTAGGA
CGTCCACCCACAAGGCCACTACCAACCGGCCTTTGTGGAAATCATTGGGG
AAGGTCTATGTTCAGCTGTGGACGTCCTGTGGCTGACATGATGCTGATGA
TGATGAAACAGAGTTAA
back to top

protein sequence of OSCA006349-RA

>OSCA006349-PA ID=OSCA006349-PA|Name=OSCA006349-RA|organism=Ostrinia scapulalis|type=polypeptide|length=138bp
MGSVTLTMVRNVKKGGIDNYYGGLPHHDLMLIQLEESLMFGVSLRDRIRN
EEIRERAKVADIAQRISKLKWQWTGHILVSSMQTDGRWGNKVLEWRRSVG
RPPTRPLPTGLCGNHWGRSMFSCGRPVADMMLMMMKQS
back to top

mRNA from alignment at newscf_2002:18941..22569+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA006349-RA ID=OSCA006349-RA|Name=OSCA006349-RA|organism=Ostrinia scapulalis|type=mRNA|length=3629bp|location=Sequence derived from alignment at newscf_2002:18941..22569+ (Ostrinia scapulalis)
ATGGGCAGCGTGACATTAACGATGGTGAGAAATGTTAAGAAGGGTGGCAT AGATAATTACTATGGGGGCCTCCCCCACCACGACCTAATGTTAATTCGTA ATTGAAATCTTGATGCTGGAGGATTTGTAAAGTAATAACATAGTTAAGGG GCCTTAACGAATTGAAGTGTAAAATCTTGTCTGTGCATCTTTTATCGCCC TAAGAGGTTGTATAAGTAGCTTTGTAGACCTCCTTTAATTTAGTCTGAGG GTGGAATGAAGAAGGCCGAGTGCATTACGCTGATTGATAGCGTTTAAAAA ATGCAGTGAGGGCTTAATGAGGTGTCTACTTAGTCTCGTACCCTAAAGTT AGAGGTGCTATCTTTGTGTCATTAATATGTAATTTTATTTTTAGTCACAC GGCCCACGGGGGAGCAGAGTGATGAAAATTAAAACATTTTTTACACGGAA AGGCGATTTACGAAGACTTTACATTTTAAGCACATRAAAGCAATTTGATA ATATAAGACCATTGAGGAAAACCTATATCCTACTTACTTACAAATAAATG CACACTACACATAAAATTGAAATGGAAAACTAAGAACCATTTTTTAAGAT AAACCACTATACCCATAAAAATGAAACTAATTTCTAATAGGTACTTCTTG CACTTTTTCCATGATATTTTATCCGTCCAATTTTACGTAAACTGGAAATA ACAGCACTGAAATCCGCTCACAAACGTAAAAAGATATTCCGTGTTTGAAG TGTTACATATACATGAGCTGTATTGATACCAGAATTGGTTAAACACAATC AGTTTATCTAAGCCAGTGGTTCTCAACCAGTGGTCCGCGGGAGCCTAAAT GGGAACCGCAAATGATTTCAAAATTAGCAGTCGATGATATTTCATTTGTC GCGCGTAGTGAGTGTTTTTTAAGTCCTCGTTCTTAAAAAAATGTGCTAGA ATTACTGACCTTGTACAAAAGACACAAGCCTAAAAATTACATCGATTAAA AATTGATTTTATTTGTACTACGATATAATCTGATCGAAGCATTTTATCGA TTTAAGACGATAATATTAACTATAAAATATCATGTCGCGTAACCTAAGTC CTATGGTCCTTGTCAACGACAAAGAAAACAAAGTGGTCCTTAGTCCAGCA AAGGTTGGGAACCACTGATCTAACCCAATCCGGTTAATCCCGCGGAACAT TAATCTCAGTTAACCGTGTCACATTCATTAAAATTTCTTCAAACGTACGT GCGATAAAACAGTGTAGTGTCGCTGAAACTTTTGCTTATCTGTGGCACGT ATGGTCGACTCTAGTGATGGGCAGAATGGAATTTATTCGAGTGACCTTTC GATCGATTAATTTGCTGTAAACATTTTCGAATAGACGAAGTTATTTACAG TGGAACCACAAGAATTGATCACTTATCGATGTTTCTGTTTAGAAGCACCT ACTCGTATTGGAATGTTTGATAATTTGATTCGTGTAAGCGAGCGATAAAC CACATCGCTGAAAACTTTTACTTATCTCTTGCACGTAGTTAGATTTTGTT ATTTGGTTGTTTGTAGTGATGGGCAACAACAACAGATAATAATAATTATG ATCGATCAATTTATTTTTATAACATTAAAGGTTATATAATATAAAAGGTT ACCCAATTTAGTAAATGTTTCAAGTAGATAACATAAAATTAAAATTATTA TAATTAATTAATGTGACCATGTTAAGCTAGGGAACCCTTATGACTGAAAT GATGATGATGATGAAAATGATGAATTAATTGTTGTGATCATTTAAAGAAA TTTTTCTTCAAACCATAGTACTTATACATATTACAAAAAAAGGTAAGTAT TAACAACCCACAATGAACATCATATTTATTCCAATGAATGAATAACTCAA AATGCACATTGGAACACTCGCCCATCACTAGTCGTTCCACGAAAATTACG GCGTGGTTTAACACATGGTACATTTANCTGATCTAACCCAATCCGGTTAA TCCCGCGGAACATTAATCTCAGTTAACCGTGTCACATTCATTAAAATTTC TTCAAACGTACGTGCGATAAAAGTGTAGTGTCGCTGAAACTTTTGCTTAT CTGTGGCACGTATGGTCGACTCTAGTGATGGGCAGAATGGAATTTATTCG AGTGACCTTTCGATTAATTTACTGTAAACATTTTCGAATAGGTAAAGCTA TTTACAGTGGAACCACAAGAATTGATCACTTATCGATGTTTCTGTTTAGA AGCACCTATTGGAATGTTTGATAATTTGATTTGTGTAAGCGAGCGATAAA CCACATCGCTGAAAACTTTTACTTATCTCTTGCACGCAGTTAATTTTGTT GTTTGGTTGTATGGTTGTGATGGGCAACAACAACAGATAAATAAATAATA TTATGACGATCGATCAATTTATTTTTATAACAATAAAGGTTTTAATATAA AAGATTACTCAATTTAGTAAATGTTTCAAGTAAGTACTTAGATAACATCA GAAAATTAAAATTATTTTAATTAGTTAATGTGACCATGTTAAGCAGGGGA ACCCTTATGACTGAAATAATGATGATGATAATGATAAATTAATTAATGTG ATCATTTAAAGAATTTTTTCTTCAAACCATAGTACTTATACATAATTACA ATTAAAAGGTAAGTATTAACAACCCACAATGAACATAATATTTATTCCAA TGAATGAATAACTCAAAATGCACATTGGAACACTCGCCCATCACTAGTCG TTCCACGAAAATTACGGCGTGGTTTAACACATNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAACGTAGCAATAACTTC GATTAAGGAACGAATTATTGGGACGCGAGCCGCAGATCGATCGACGCTTC AAGGTCTAGAGGGTATTGTAACTAATATTATCTGTGCGCCGAATACCAGT ATYATTTTTGTGGGAGCTATCTGAGAAAATGTGGAATAAATGACATACGA TTTAAAAGGCCAAATACAGAGTGAGGATAAAAAATATATCACACACTTAA TAGCTATAACTTTACTTTCCGACTTTTTCACACTGAGTTTTTCACGATGA TCTTACATCATTCTAATGGTCTCATCAAACTAAGTACCTCCATGTCAAAT AAACTTTAAACAGAGTTGGAGGAGAGTCTTATGTTCGGTGTTTCTTTACG AGATCGAATCAGAAATGAGGAGATCCGTGAGCGAGCTAAAGTCGCTGATA TAGCCCAACGGATCAGCAAACTGAAGTGGCAATGGACAGGGCACATACTC GTAAGTAGTATGCAGACTGACGGCCGATGGGGCAACAAGGTTCTGGAGTG GAGGCGCAGCGTAGGACGTCCACCCACAAGGTAGACCGACGACCTCATAA AGGTGGCAGGAAGCCGCTGGATGCAGGCCACTACCAACCGGCCTTTGTGG AAATCATTGGGGAAGGTCTATGTTCAGCTGTGGACGTCCTGTGGCTGACA TGATGCTGATGATGATGAAACAGAGTTAA
back to top

Coding sequence (CDS) from alignment at newscf_2002:18941..22569+

>OSCA006349-RA ID=OSCA006349-RA|Name=OSCA006349-RA|organism=Ostrinia scapulalis|type=CDS|length=417bp|location=Sequence derived from alignment at newscf_2002:18941..22569+ (Ostrinia scapulalis)
GCCACTACCAACCGGCCTTTGTGGAAATCATTGGGGAAGGTCTATGTTCA
GCTGTGGACGTCCTGTGGCTGACATGATGCTGATGATGATGAAACAGAGT
TAAAGTTGGAGGAGAGTCTTATGTTCGGTGTTTCTTTACGAGATCGAATC
AGAAATGAGGAGATCCGTGAGCGAGCTAAAGTCGCTGATATAGCCCAACG
GATCAGCAAACTGAAGTGGCAATGGACAGGGCACATACTCGTAAGTAGTA
TGCAGACTGACGGCCGATGGGGCAACAAGGTTCTGGAGTGGAGGCGCAGC
GTAGGACGTCCACCCACAAGATGGGCAGCGTGACATTAACGATGGTGAGA
AATGTTAAGAAGGGTGGCATAGATAATTACTATGGGGGCCTCCCCCACCA
CGACCTAATGTTAATTC
back to top
Synonyms
The feature 'OSCA006349-RA' has the following synonyms
Synonym
augustus-newscf_2002-processed-gene-0.0-mRNA-1