OSCA010079-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA010079-RA
Unique NameOSCA010079-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length793
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_2000contignewscf_2000:6156..9829 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.24
QI40|0|0|0.83|1|0.83|6|0|251
AED0.21
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA010079OSCA010079Ostrinia scapulalisgenenewscf_2000 6156..9829 -


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA010079-RAOSCA010079-PAOstrinia scapulalispolypeptidenewscf_2000 6156..9789 -


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA010079-RA:cdsOSCA010079-RA:cdsOstrinia scapulalisCDSnewscf_2000 6156..6303 -


The following five_prime_UTR feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA010079-RA:five_prime_utrOSCA010079-RA:five_prime_utrOstrinia scapulalisfive_prime_UTRnewscf_2000 9790..9829 -


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA010079-RA:exon:2940OSCA010079-RA:exon:2940Ostrinia scapulalisexonnewscf_2000 6156..6303 -
OSCA010079-RA:exon:2941OSCA010079-RA:exon:2941Ostrinia scapulalisexonnewscf_2000 6436..6644 -
OSCA010079-RA:exon:2942OSCA010079-RA:exon:2942Ostrinia scapulalisexonnewscf_2000 6677..6747 -
OSCA010079-RA:exon:2943OSCA010079-RA:exon:2943Ostrinia scapulalisexonnewscf_2000 7431..7510 -
OSCA010079-RA:exon:2944OSCA010079-RA:exon:2944Ostrinia scapulalisexonnewscf_2000 8790..8998 -
OSCA010079-RA:exon:2945OSCA010079-RA:exon:2945Ostrinia scapulalisexonnewscf_2000 9754..9829 -


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA010079-RA ID=OSCA010079-RA|Name=OSCA010079-RA|organism=Ostrinia scapulalis|type=mRNA|length=793bp
TGACCTGAGACTAGAAGATGGAAGACCAGTTACAGCTCAAATGGTGCTTC
TATGTGCTTGGAGATCAGTGAAAGAGACTCCGTCCATCTTCACTGATCCC
CAGGTGTCCAGCATTCTCGGCACGCTGGTGGCCCGAATGAGCATCGAACT
GGAGGACGAGACGGGCTTACTGTCGCACGAGCAGCTAAATCGCATCGGCC
AACACTTCACCCAACTGCTGGCTGAGACCAAGCATCGGGGCGCGTTTGAG
CAGGCGTATGTAGGCTTCTCCAGGATGCTGACCAGTGACCTGAGACTAGA
AGATGGAAGACCAGTTACAGCTCAAATGGTGCTTCTATGTGCTTGGAGAT
CAGTGAAAGAGGTTAACGACGTGTACATTGTTCCCATTAAAATAATAAAA
ATAAAACTAACTGTAAAGGCAGGGAGCAGTTGTGAGAGTCGGCCCATCTT
CACTGATCCCCAGGTGTCAAGTATTCTCGGCACGCTGGTCGCCCGGATGA
GCATCGAACTGGAGGACGAGACGGGCTTGCTGTCGCACGAGCAGCTAAAT
CGCATCGGCCAACACTTCACACAACTGCTGGCCGAGACCAAGCATCGTGG
CGCGTTTGAGCAGGCGTATGTGGGCTTCTCCAGAATGCTGACCAGCCATA
GGACGTCCACTGCTGAACAAAGGCCTCCCCCAATGCAATGTACCGGAAAA
CGCAGCGTGGGACGTCCACCTACAAGGTGGACCAACGACATCGTAAAGGT
AGCAGGGAAGCACTGGACGCAGGCCGCTACCAATCGATCAACA
back to top

protein sequence of OSCA010079-RA

>OSCA010079-PA ID=OSCA010079-PA|Name=OSCA010079-RA|organism=Ostrinia scapulalis|type=polypeptide|length=251bp
MVLLCAWRSVKETPSIFTDPQVSSILGTLVARMSIELEDETGLLSHEQLN
RIGQHFTQLLAETKHRGAFEQAYVGFSRMLTSDLRLEDGRPVTAQMVLLC
AWRSVKEVNDVYIVPIKIIKIKLTVKAGSSCESRPIFTDPQVSSILGTLV
ARMSIELEDETGLLSHEQLNRIGQHFTQLLAETKHRGAFEQAYVGFSRML
TSHRTSTAEQRPPPMQCTGKRSVGRPPTRWTNDIVKVAGKHWTQAATNRS
T
back to top

mRNA from alignment at newscf_2000:6156..9829-

Legend: exonfive_prime_UTRpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA010079-RA ID=OSCA010079-RA|Name=OSCA010079-RA|organism=Ostrinia scapulalis|type=mRNA|length=3674bp|location=Sequence derived from alignment at newscf_2000:6156..9829- (Ostrinia scapulalis)
TGACCTGAGACTAGAAGATGGAAGACCAGTTACAGCTCAAATGGTGCTTC TATGTGCTTGGAGATCAGTGAAAGAGGTTAGTAATAATCATTTTCATTGT GAAATTATGAATGAAATATATAAGTTGGGCAAGAAAACATTAATAGCCTG AACACTAAGAGATTCGATGAGGGAAAGTACTTACAGGATGGAAAAATTAA TGTTATATTGAACATGGAATCATACTCGCTTGATATACAGAACCTATCGT TAACACACTTGTTTGGTACCTTTTGATTTACATATTTAGTTTGCTTTGGC GAATACCGAACTTTACGACCATATTTCGTGGCACTTATCACAAACATCTT CATTCTTCGGATCAAATACTTAGGTGTAATAGTTTGTCCCGGCTAATGTC ATGAAGTATTATAAAAGGCATTTGGGTGACTTTTATAACATCTGTAAGTT ACTTGCCTTGAACCCATCTCTATTCCACCAGTAAGCCATACGTCGTTGGC ATAAGTCTTTTTACATTGAAATATGCTCTATAACTGATAATTTGTGTATG TATGTAGATTATAAAGTGAATATTAAATTAAAAATGTCAATCAAGTTCAT ACTGTGTAATTTTATGTTTATTTTTAATATATTTTTCTCTTTTATTTGTA TAAATCTAAATTACATAGTGTGGCTGTGGGTACACATTTTTGTGCTTGTG ACTGTACATTGTATTTTTTTTATCTTTTCTTCACATGTGTACATGTTWCC AATAAAATAATAAAAATAAAACTAACTGTACAGGCAGGGAGCAGTTGAGG TAAGCTGTCGCATTTGGTTTCTCCCTCTCAGACTCCGTCCATCTTCACTG ATCCCCAGGTGTCCAGCATTCTCGGCACGCTGGTGGCCCGAATGAGCATC GAACTGGAGGACGAGACGGGCTTACTGTCGCACGAGCAGCTAAATCGCAT CGGCCAACACTTCACCCAACTGCTGGCTGAGACCAAGCATCGGGGCGCGT TTGAGCAGGCGTATGTAGGCTTCTCCAGGATGCTGACCAGGTGAGAAAGA TATTTTGCTTGCTAGAAGCTTCTACGTCATCATTTCAGCCTCTCAAAGAC CACTACGTAGTACGATCTATAATAATAATAATAAATCCTTTATTTAACAA AGATTACAACTAAGTATTGCTAGTGGTCCCCAAACTAGGTTACACCTGTC TCTTGGGGTGTGGAGTGCGAGGCTTGAAGTTAAATGGCGTTGTAAATGCA CTTTATGCTAGTAACATCTCCCGCTATCTTCTTGAAGTCATCAGATCATT GTTGTCGATATATTATCTCAATTCATGATTTAACAATCAAGTAAATTCTC GTCTTCCTCGCAAAATCTTCTTTACATTCTTATCTTTCCCTTATGCAAAA ATCTCTCTCTTTTTCTTGTTCATTATTTTTCACTTTGTTCTGTGTTCTGT TACACTTACGATCCCATTTGTATTGCTTAATCGACATAGTACTCCAGGAG ACGTGTGGCCCGTGGTTTAGCTTCACAGTCATGCGTTTCATGTTTCACAC ACATTTTTTTTATCATCTGTTAACTGTAAAAAACCCAAACAATTTAAGAG AATATCGGGACGTTCGAATACTCAAAACTTAGTATACTCATCATCATCAT CAACAGCCCTTTACAGTCCACTGCTGGACTATGACTATGAGCCTACTCTA CTATAGTGGGGGGTTTTGCCATAATCCACACGCTTGGCAGGCGGGTTTGA GATCACAGTTTAAAAGATTGATGTTTTTCAGAGAACGCTGCTGCCCGTTC TCTGTTTGATATGTAGTCCGTAAGTCGCCTCTTACGACACCCGCGGGAAG AGTAGGGGTTGGTGACAAATGAATTCTACTCTGCCGTCACCACACGGCTA ACTATACTGCCTCTAATTAACATTAAGATTTATTTAGTGTAAAAAGTCAG CGGCGGTCACCATTTTATCAGTAAGAAAAGAGGCCTTGGGGTGGGTTGCA CCATCTTACTTTAACTTTAACAAACGTCAAGGGGCTGTCAAACTCCATAT AGAAGGGACCGGTTGTTGTGGTCGCGATTGGGGCGGGGTGGTGCAATTCA ACCTAAGTGTTTTACTTGGCGTGCCGTCGTCTGTACCTATACGTATAATG TTATTTAGAGGCTATGTAATAACAGTATTGTGAGAACTGCNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNAGCTAGAGGCCTTTATCTACACATT TCTAAATTCTAAATTCTAGTGACCTGAGACTAGAAGATGGAAGACCAGTT ACAGCTCAAATGGTGCTTCTATGTGCTTGGAGATCAGTGAAAGAGGTTAG TAATAATCATTTTCATTGTGAAATTATGAATGAAATATATAAGTTGGGCA AGAAAACATTAATAGCCTGAACACTAAGAGATTCGATGAGGGAAAGTACT TACAGGATGGAAAAATTGGTGTTATATTGAACATGAAATCATACTCGCTT AATAAATATACAGACCCTATCGTCAACATACTTATTTGGTACCTTTTGAT TTACATCTTTAGTTTGCTTTGGCGAATACCGAACTTTACAAACTAAATGA GAGATCACTACGACCATATTTCGTGGCACTTATCACAAGCATCTTCATTC TTCGGAAAATACTTAGGTGTAATAGTTTGTCCCGGTTAATGTCATGAAGT ATAATAAAGGGCATTTAGGTGACTTTATAACATCTGTAAGTTACTTGCCT TGTACCCATCTCTATTCCACCAGTAAGCCATACGTAGTTGGCATTAGATA TTCTTACTTTTAAATATGCTCTAAGTCTAACTAATATGTGTATGTTGTAT GTAGATTACAAAGTAAATATTAAATTAAAAATGTCAATCAAGTTCATCCT GTGTAATTTTATGTTTATTTTTAATATATTTTTCTCTTTTATTTGTATAA AATTAAATTACATAGTATGGCTGTGGGTATACATTTTTGTGCTTGTGACT GTACATTGTAATACTTTTTATATTTTCTTCAGACGACGTGTACATTGTTC CCATTAAAATAATAAAAATAAAACTAACTGTAAAGGCAGGGAGCAGTTGT GAGGTAAGCTGTCGCATTTGGTTTCTCCCTCTCAGAGTCGGCCCATCTTC ACTGATCCCCAGGTGTCAAGTATTCTCGGCACGCTGGTCGCCCGGATGAG CATCGAACTGGAGGACGAGACGGGCTTGCTGTCGCACGAGCAGCTAAATC GCATCGGCCAACACTTCACACAACTGCTGGCCGAGACCAAGCATCGTGGC GCGTTTGAGCAGGCGTATGTGGGCTTCTCCAGAATGCTGACCAGGTGAGA AAGATATTTTGCTTGCTTCTACGTCATCATTTCAGCCTCTCAAATACCAC TATAGATCGTGCCACAGACGTGCCCCACCATTCTTCCGCTAATGTTTGAG TGTTATCATCATCATCATCATTTCAGCCATAGGACGTCCACTGCTGAACA AAGGCCTCCCCCAATGCAATGTACCGGAAAACGCAGCGTGGGACGTCCAC CTACAAGGTGGACCAACGACATCGTAAAGGTAGCAGGGAAGCACTGGACG CAGGCCGCTACCAATCGATCAACA
back to top

Coding sequence (CDS) from alignment at newscf_2000:6156..9829-

>OSCA010079-RA ID=OSCA010079-RA|Name=OSCA010079-RA|organism=Ostrinia scapulalis|type=CDS|length=753bp|location=Sequence derived from alignment at newscf_2000:6156..9829- (Ostrinia scapulalis)
ATGGTGCTTCTATGTGCTTGGAGATCAGTGAAAGAGACTCCGTCCATCTT
CACTGATCCCCAGGTGTCCAGCATTCTCGGCACGCTGGTGGCCCGAATGA
GCATCGAACTGGAGGACGAGACGGGCTTACTGTCGCACGAGCAGCTAAAT
CGCATCGGCCAACACTTCACCCAACTGCTGGCTGAGACCAAGCATCGGGG
CGCGTTTGAGCAGGCGTATGTAGGCTTCTCCAGGATGCTGACCAGTGACC
TGAGACTAGAAGATGGAAGACCAGTTACAGCTCAAATGGTGCTTCTATGT
GCTTGGAGATCAGTGAAAGAGGTTAACGACGTGTACATTGTTCCCATTAA
AATAATAAAAATAAAACTAACTGTAAAGGCAGGGAGCAGTTGTGAGAGTC
GGCCCATCTTCACTGATCCCCAGGTGTCAAGTATTCTCGGCACGCTGGTC
GCCCGGATGAGCATCGAACTGGAGGACGAGACGGGCTTGCTGTCGCACGA
GCAGCTAAATCGCATCGGCCAACACTTCACACAACTGCTGGCCGAGACCA
AGCATCGTGGCGCGTTTGAGCAGGCGTATGTGGGCTTCTCCAGAATGCTG
ACCAGCCATAGGACGTCCACTGCTGAACAAAGGCCTCCCCCAATGCAATG
TACCGGAAAACGCAGCGTGGGACGTCCACCTACAAGGTGGACCAACGACA
TCGTAAAGGTAGCAGGGAAGCACTGGACGCAGGCCGCTACCAATCGATCA
ACA
back to top
Synonyms
The feature 'OSCA010079-RA' has the following synonyms
Synonym
maker-newscf_2000-snap-gene-0.7-mRNA-1