OSCA011725-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA011725-RA
Unique NameOSCA011725-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length2868
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_126contignewscf_126:8111..24419 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.15
QI0|0.71|0.5|0.87|0.71|0.87|8|1527|446
AED0.15
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA011725OSCA011725Ostrinia scapulalisgenenewscf_126 8111..24419 +


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA011725-RAOSCA011725-PAOstrinia scapulalispolypeptidenewscf_126 8111..22892 +


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA011725-RA:exon:12OSCA011725-RA:exon:12Ostrinia scapulalisexonnewscf_126 8111..8194 +
OSCA011725-RA:exon:13OSCA011725-RA:exon:13Ostrinia scapulalisexonnewscf_126 12995..13217 +
OSCA011725-RA:exon:14OSCA011725-RA:exon:14Ostrinia scapulalisexonnewscf_126 15929..16066 +
OSCA011725-RA:exon:15OSCA011725-RA:exon:15Ostrinia scapulalisexonnewscf_126 20466..20661 +
OSCA011725-RA:exon:16OSCA011725-RA:exon:16Ostrinia scapulalisexonnewscf_126 21006..21168 +
OSCA011725-RA:exon:17OSCA011725-RA:exon:17Ostrinia scapulalisexonnewscf_126 21382..21615 +
OSCA011725-RA:exon:18OSCA011725-RA:exon:18Ostrinia scapulalisexonnewscf_126 22393..22590 +
OSCA011725-RA:exon:19OSCA011725-RA:exon:19Ostrinia scapulalisexonnewscf_126 22788..24419 +


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA011725-RA:cdsOSCA011725-RA:cdsOstrinia scapulalisCDSnewscf_126 22788..22892 +


The following three_prime_UTR feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA011725-RA:three_prime_utrOSCA011725-RA:three_prime_utrOstrinia scapulalisthree_prime_UTRnewscf_126 22893..24419 +


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA011725-RA ID=OSCA011725-RA|Name=OSCA011725-RA|organism=Ostrinia scapulalis|type=mRNA|length=2868bp
ATGCCCTCGGTACAGCTGTTCAAGCCAGTTCAGGTCCACCGGCCTGGAGC
CTCGCTGTGCGTCACGCGCAGTGGTCGCGAAAGGATGCACGCTTCGTCTT
CGCCTCCCCTGGTCGACTGGTCGGGAGTTCCTACCCTGGTGCTGCTAGTG
GCTGCTGTTCTGGTGGCTGTCACCGCCTTGGTGGCTCGCGCAGCAGACGC
CAAGCACGCTGCCAGGCTGCCTGGTCCACCAGCTCTACCGTTCCTNGGAA
CGCGTTGGCTGTTCTGGAGCCGTTACAAGATGAATAAACTTCACGAAGCT
TATGAAGACATGTTCAGGCGTTACGGGCCGGTGTTTGCGGAGACGACGCC
AGGGGGCGCCATGGTGGTGTCCATAGCGGAACGGGCGGCCCAGGACCTGG
ACCCCGGCCCAGAGGCCCTATCGGCCCCCCACGGAGATCGTCCAGCCGTN
TGTGGCCTGATGCTGGGAGCCCGTCTCGGGTTTCTCGAGCGTTGCATGTC
GGGGCGNGCCGCGACCCTGGCTGCGGCGGTCAAGGCGCACTTCCGAGCCC
AGAGGGACTCGTATTACGGCGCGCCACTCTGGAAGTTTGCCCCCACGACC
TTGTACAGAACCTTTGCGAGGAGCGAGGAGACCATTCATACGATAGTATC
GGATCTAATGGAGGAGGCCAAGTCGCGGTGCAAGGGCGCCGCGCAGGANG
ACGGCATGCAAGAGATCTTCCTGAAGATCCTGGAGAACCCTGCTCTGGAC
ATGCGGGACAAGAAAGCGGCCGTCATCGACTTCATCACAGCCGGCATTGA
GACGTTAGCAAACAGCCTAGTGTTCCTGTTATACCTGCTAAGCGGCCGAC
CCGACTGGCAGGAAACTATACGTTCGGAAGTGCCTTGCAGCGGCGAGCTC
AGGGCTGAGGAGATGGCTGCAGCACCGTCCATAAGGGCGGCCATCAACGA
AGCCTTCAGGCTGCTACCCACCGCGCCCTTCTTGGCCAGACTTCTGGAAG
CACCCATGACTGTGGCTGGACATAAGCTACCTGCTGGGACATTTGTGCTG
GCTCACACTGGTGCTGCTTGTCGTCGTGAAGAGAACTTTTGGCGTGCGCA
GGAGTACATTCCGGAGAGATGGCTGGTCGGCAAGGAGCCTCACGCAGCGT
CGCTGGTCGCGCCATTCGGACGAGGGCGGCGGATGTGCCCGGGCAAGCGA
TTTGTCGAGTTGGAGCTACATTTACTGCTCGCAAAGATAATGCAACGTTG
GAGAGTGGAATTTGACGGGGATTTGGACGTCCAGTTTGACTTTCTGTTAT
CTCCCAAGTCACCGGTGTCATTGCGACTCGTCGAGTGGTAGTTACCCACT
CCATTCCTACCTCTATAGGTAGTCATAACCATACGATTAAGTGAAGAAAT
CGCTAGCTTACAAGACAGACGTGCTTACTTAAATTGTACACGTTTTGAGC
GAGTTCCATTTATGTTAGCGTAATTGATATGCTCATAACGTAATGCTCAT
TGTATTTGAATAGTTTTAATGTTAACTTTAATTACTATATTTAGCTATCC
GCTTGGATTGAGCATGTTAAGTACCAGCTTATAGGAAACATGGGCTTTCT
TTTGTACTGGAGAAAAACCTAAAACATCCGTTTAGTCCAAGCTAACTTAA
AGACGNTCCAACTTCGATTATTTACTCACAAATAAGTTATAAGCATTTTC
GTCTTAACCAAAGAAATATAAACAGTACTTCCGAAACACGCCTTATTAAA
TATAAGTAGCATGTATGTATTATTGTGTAAGTTTTTGGTCCTTCGAGCCG
GATATTAAACTCGGTTGCCATGACGGAGCTCGAGCGTGAGAGTTACAGGG
TACCGGCACTGTCTGCTCAATTTGATCACGTCTTTTTAGTTTTTAAGTGC
TGTCCACAAATTATAAGTTAAGTACGTATTTTATATTACATTTACAAAGT
ATCGCTAAATTAGTGTGTAACTTTACAATATTATAAAATATGGCTGTGTT
AATGTCAAAAAACGTATTTATATAAAATTATAATAAACCGAGAATACCTC
TTGTTAATAAGACTGCGTACCGCCAGCATACGAGCATTTTGTCAGCATTT
ATAAACCATGTATTGCAAGAGTATGTTAAGTCTTAGGTAAGGTAATATTA
CTATGATTAATTGAGACATCATCTATAGTAATGTATGTGACTACTTATTT
ATTTAACTATGATCATTCCCTGTAATGTTTGGTAGCATAAATAATAAGGG
TATTTATGCTAGCCCGATGTAGTGGCCATTTCATATTAACTGTATGTGTT
GACACAATGTACCCTCTAATATGGAGTTAGTTATATCTTTTCAACTCGTG
GTATAGAACGTGTNATTGAGTTAAAGTAAGACTTTGTAAGAATACAGATT
TTAATATTTTTGTATCGCGCGCTGTCTAAAACTTAGACGCGCAGTGCCAT
GCATACCTCAGTGAAACCTAATGAAATGGTTGTGTAGGGTTACGAATAAA
AGAAAATACACATGCAATTTAAAACAATTTACACAATAAAAATATGAGTG
GTGTCTGTCTGGGCTTTTACGTTATTTCAATTACACGTTTTATAAATAAA
TTATGATTAAATGTATAAATAAAATAGGGATAAAGCATATACTCAGTGAA
AACCTATTTTTATGTTCTAACCATTAAAAATCTGTATATTTTGTTTGAAA
GAGATATAATTTAATGGTATTGTTGTATGAGTTTTTATATCTCCCTCGGT
GATCCTTTTCATTTCCGTTACTTTTAGTTATGGTTGAGATTTGTTTATTT
TGTTCACCTTGTTTTGTATGACTAATCACATTGTTATGAATAAGTATTTT
ATTGTAAATTATCTTATA
back to top

protein sequence of OSCA011725-RA

>OSCA011725-PA ID=OSCA011725-PA|Name=OSCA011725-RA|organism=Ostrinia scapulalis|type=polypeptide|length=446bp
MPSVQLFKPVQVHRPGASLCVTRSGRERMHASSSPPLVDWSGVPTLVLLV
AAVLVAVTALVARAADAKHAARLPGPPALPFLGTRWLFWSRYKMNKLHEA
YEDMFRRYGPVFAETTPGGAMVVSIAERAAQDLDPGPEALSAPHGDRPAV
CGLMLGARLGFLERCMSGRAATLAAAVKAHFRAQRDSYYGAPLWKFAPTT
LYRTFARSEETIHTIVSDLMEEAKSRCKGAAQXDGMQEIFLKILENPALD
MRDKKAAVIDFITAGIETLANSLVFLLYLLSGRPDWQETIRSEVPCSGEL
RAEEMAAAPSIRAAINEAFRLLPTAPFLARLLEAPMTVAGHKLPAGTFVL
AHTGAACRREENFWRAQEYIPERWLVGKEPHAASLVAPFGRGRRMCPGKR
FVELELHLLLAKIMQRWRVEFDGDLDVQFDFLLSPKSPVSLRLVEW
back to top

mRNA from alignment at newscf_126:8111..24419+

Legend: exonpolypeptideCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA011725-RA ID=OSCA011725-RA|Name=OSCA011725-RA|organism=Ostrinia scapulalis|type=mRNA|length=16309bp|location=Sequence derived from alignment at newscf_126:8111..24419+ (Ostrinia scapulalis)
ATGCCCTCGGTACAGCTGTTCAAGCCAGTTCAGGTCCACCGGCCTGGAGC CTCGCTGTGCGTCACGCGCAGTGGTCGCGAAAGGGTTAGTTAAACTAAAC GCGCTATGTTATTTTATAAGGTTTCGCTTTTATAAATAAAGATTAGCTTG AGTAGTGATTTTTAATTAGTTTGCCATGGCCTGCTTCCTAGCTCCATTAT CTGCCAACAGACTGATATCATTCCTAAGTTACACACGTACCTACCTAGAA GTTAACATTATGTATTTATACGAAAACATTCGTGAATATAATGTTGTTAT GTTATTGAGAGAGGCTATAATTAGGTAATGCTTGTTGTTGTTATTGAGTC TTTATGCAAGTAATTTAACACCAAAAACACACATTCTCGTAGCAAATAAA CAAATCCAATCACCTGTTTTGACTGTCATTAATGATGATGATTTWAACTA TTGACATTTGCAACACCGAAGAGTTGCGATGNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATAA TGAATGTTCTTTTTGCTATTATTTTCATTTATTAATTTTTGCTGTGCATG CAGGCTTTTTCTACCTGTAATTGAATACGTGCTGAAACAAGGCCGATATT ACAAATTGAGGTTTTGATATTAGGAGCTTCAACCTTCACCTTTTATAATC TGCATTGTTATTAATCACTACCTTTGTTCGCGGTTCCTCTTATGTTACTG GGCTCACCCAMTAAGTGCCTGATTTTCAGGGGATACACCGTACCTATAAT ACTATAACCAAAAAATTTAAGCTTATAAAGCTCGGAAAACTTCAGTAGAA ATATTTCCCGTATTTAGATGAAAAGTAGCCTGTTTGAGCTTTTAAGCTCG GAAAACTTCAGTAGAGACTTTTCCCGTATTTGGATGAAAAGTAGCCTGTC ATCCAGGTAGGTAGAAATATGATAGTTTTGATATGTTTATGTAAAATAAT TTGCAGAATCGGACCACTCCACTTTTAGCGATTACCCCCTATAGATGTTT AAACACGAAAGCAATTAAAACTGACCTTTTTATAATAGACTGAACTCATC CAATAAAATAAGTTTGATTTATCGCCCAAAATAATCTGTTCCAAATTCAA GGTTAAAAGCAATTAAAACGTGTCCTCTGGATATTTCGGTTGGCACRGCA ACAAAATCGARCCGGGTCCTTTTTTGCGTTTTGTTTGGGGTTGGCTAAAT TCAGAGCTTGTCTGGAYCACTGCCGCCGATCGGTTAAAAAGCCAATTAAG AAAATCAATTGATGTCTGCGACTGCATCTGTTCTATAATGCCCGCAGTAA TTATTCTAGCTGAATTATTTTTTTAATTATAGCGGTGATGCCGGACTCGC CCACGTTTGTGATTCCAAYGAATCTGACGGCATGCGCAATTAAGATNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NATCGTGTGAATACGGGCGTTAGTCTTATTGATTTATTGTTTCGTGTTCT GATAGCACAATAATTTGGGTCAGTTTTAACAACAACTGGTTATCTGAAGT GCACTGGGTCTAGCCTAGTTGRAGTCTAGCTTGATTTATGAATGACGAGC CTAACTCGGTCATGTTCACTTTGTTGGCCGCTGCGATGACACTTTGATTG ATATACTAAGAATTACTAATATGCTGGTTTCACAATATTTGCTAATTCTA AMTTGTATAAAGTTTGGAAAATTAATAATATGTATTAATTAGAAGTAGTA ACTTCTATTACAAACTTTGATGTAGGTCTTCTTGATTTGATACAATACAT ACAGCAAAGCTTCGGGGAGCTTTTAACTGAATTTATACACAATATAGCCA AATACTGGCTCTTATGGTAAATATGTGTAAGCTTTCAAACTAACCATTTG ACTAGACGGCTCTGAAGTTCACTGAACCATGTAACCGTAGCAATGACACC CATGAAATCTGACTCTACTAAGTAGCTATCTAGTAGAGTAGGTTAGTAGA CGAGCCCTCAGATTAAAAGGGATATCAACTGGTATAAATTGCTGTTATAC AAATCCTGTTTGRTGTCGCTAAGTGCAAACTGGTACTCAAAGGGTGATGT GTACTTATCTCCCATCTGATATCTGCCCGTTACTTTAAACCGGGGTCGGT TACTGTGCAAACTAGGGTCCGCATTTCAAGGAACTCGTTAAGNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNGTCGTCGTTATCAATCATCGTCAAGCGGAAGCTTTTAT GAGAATAGGTCCATTTATATGATAACAATATTCTTGAATTGAAAATAATT TTAAACTTAGTTCACAATAATTTTTTCGGCGTACCCTTTTATTCTTCCAA CAGGAAACTACAACAGCTTTCATTTTGCCCACAGATGCACGCTTCGTCTT CGCCTCCCCTGGTCGACTGGTCGGGAGTTCCTACCCTGGTGCTGCTAGTG GCTGCTGTTCTGGTGGCTGTCACCGCCTTGGTGGCTCGCGCAGCAGACGC CAAGCACGCTGCCAGGCTGCCTGGTCCACCAGCTCTACCGTTCCTMGGAA CGCGTTGGCTGTTCTGGAGCCGTTACAAGATGAATAAACTTCACGAAGCT TATGAAGGTGAGATATTCAAATTGATTTTATATGAAGGAATTGAATTAAG AGATGAATGCCCGATTGCTGAAAGATGCGTGAAGTTAACGCTCTGCTATC ACCGGTTACTTATTGTGGTATACGATTATTTGCTATGCTAAAATGTAAAR AGTGACAAGGTGATTTTTTCTACTCGATAAATTTTAATAACAGTCACATA AAATGATATTAGGTAGGTATGTGTTAATTTACATACCTAAATGATTAATA AACTTTGGACGTTAGACTCATCATGGGCTTACGAGTAGAATTTAAATACT CGTACTAATCTACTGCAAAGGATTTTCATATTAAATGCTTTACGATTGGC ATGGAAAATAACGGAAATATTATTAAAAAGTAAGATAATTACACATTTGA TGGAACATTTACATAATTTTTATGACAGCTCATTAGTGAAACAGTGTGGC CGGCTAAGGATATGTAATAGACTCCATGATATCTCGATTATACCGGTTTG AGTGGTGGTTGCGTGGAGCTAAATTGATATTCCAAGGCATACGTGCTAAA TAAACCTGTTACATTTGAAGACTTTGACAGGCTTGCGGTAAATCTGGTTC TACTTGCTCCAATAGAGATATCAAATCCTGAAAAAATGTTTACTTAATCT AAACATTTTGGTGCATGCTCATATAACATACAACCCAGACTGTCTGTGGT GCCTTAGAACAAGGAGGGCGACCCCAAATAAAATGGGGAAAGGCACCTTG AGAAGGAGATCCATAGGTACTATCATATTATGTAACCNAATGTGAATTAA ACTGGTAATTTTTACAAAAAAGTCGGGACTGGGCCCATAACCTAATAAAA CGCATTGGTTGTTCAGCACAGACTATTATTTTTTTGACAAACCCGTAGTT AGTACACATTACACATACATACACTAGGTGGCAGCACTGTCAGACATTTT GTTATCTGTATTACAACAGTAATAACGGTCACATAAAATGATAATAGGTA TGTGTTAATTTACATACCTAAATGTTTAATAAACTTTGGACGTTAGACTC ATCATGGGCTTACGAATAGAATTTAAATACTCGTCTAATCTACTACAAAG GATTTTCATTATTAAATGCTTTACGATTGGCATGGAAAATAACGGAAATA TTATTAAAAAGTAAGATAATTAGCACATTTGTTGGAACATTTACATAATT TTTATGACAGCTCATTAGTGAAACAGTGTGGCTGCCTAAGGATATGTAAT AGACTCCATGATATCTTGATTATACCGGTTTGAGTGGTGGTTGCGTGGAG CTAAATTGATATTCCAAGGCATACGTGCTAAATACACCTGTTACATTTGA AGACTTTGACAGGCTTGCGGTAAATCTGGTTCTACTTGCTCCAATAGAGA TATCAGATCCTGAAAAAATTTTTACTTAATCTAAACATTTTGGTGCATGC TCATATAACATACAACCCAGACTGTCTGTGGTGCCTTAGAACAAGGAGGG CGACCCCAAATAAAANATAGCTTTATTATACAACGAATCGGTACTGTACT TCACTGCTATTATTTTTATGTTTACCTTCCTTCACTTCTGCAGCATTTTT CTCGCTTTTCCTTTTATTTCTGCTTGAAATGAATTTTCTTAAATGCATAA AGTAAGCACGTTCATCTAACAAGGCCAATCCTGCCCTTGGCATTGCAGTT AGTGTTTTCTATACCAATGTTATGAATGCGAAAGTAATTCAGTCTGTCGG TCAATATGTTACATTTTGTAATGTTTAATATGGACATATCAAGCCCAGGG AATAACAGGATAGTTTTTATCCCAGTTTTATTTGAAAGGAGGACACTCGC GTTCCCATCAAACCCCAAGCGGTCGCAGGACCACGTAACAATTTCATTTC TTTTGTGTCTCGATTCACTGAGAATTGAATGGTTTAAATTTCTTTCTGGC CGAAAACTTGCCTTGTTTTGCATAAAAAAAAAACTCGAGCGAATCCGCGG GAAAGAGCTAGTAGAAGAATATTAATACTTATCTTTCGGTATTGTTAATG CTGCTGAAGCGAATTGTACCTACGATTGCACCCGCTGTCACAATGAGAGA TTTGCACGCAGACATGTTCAGGCGTTACGGGCCGGTGTTTGCGGAGACGA CGCCAGGGGGCGCCANATAGCTTTATTATACAACGAATCGGTACTGTACT TCACTGCTATTATTTTTATGTTTACCTTCCTTCACTTCTGCAGCATTTTT CTCGCTTTTCCAACTATTTATGCTTAAAATAAATTTTCTTAAATGCATAA AGTAAGCACGTTCATCTAACAAGGCCAATCCTGCCCTTGACATTGCAGTT AGTGGTTTCTATACCAATGTTATGAATGCGAAAGTAATTCAGTCTGTCGG TCAATATGTTACCGTTTGTACTATTTAATATGGACATACCAAACACAGGG AATAACAGGATAGTTTTTATCCCAGTTTTATTTGAAAGGAGGACACTCGC GTTCCTATCAAACCCCAAGCGGTCGCAGGACCACGTAACAATTTCATTTC TTTTGTGTCTCGATTCACGAGGAATTGAAGGGTTAAAGTCTTTCTGGCCG AAAACTCGGGCAAATCCGCGTGTAAAAGCTAATCATTATTTTTATTTCGG TCTTGTTAATGCTGCTGAAGCGAATTGTACGATTGCACCCGCTGTCACAA TGAGAGATTTGCACGCAGACATGTTCAGGCGTTACGGGCCGGTGTTTGCG GAGACGACGCCAGGGGGCGCCATGGTGGTGTCCATAGCGGAACGGGCGGC CCAGGACCTGGACCCCGGCCCAGAGGCCCTATCGGCCCCCCACGGAGATC GTCCAGGTGTACCGGAGGAGCCGGCCTGATAGATACGCGTCCACTGGGCT TGTTAACGAGTAAGTAGATATTTATAATGTAGTATTTCTCTGGTAAACCT GTCCTTATCACGGTATCTTAGGCAGGCATTTAGTAAATAAATATCCTTGG TCATGCAGCGTCATCTAGCCCCGAAGTAAGCACATGGGCACCAGWCAATG AATACAGGTAAAATATTTCAAATCTCTGGGGGGCGCCATGGTGGTGTCCA TAGCGGAACGGGCGGCCCAGGACCTGGACCCCGGCCCAGAGGCCCTATCG GCCCCCCACGGAGATCGTCCAGGTGTACCGGAGGAGCCGGCCTGATAGAT ATGCTTCCACTGGGCTTGTTAACGAGTGAGTACCTACCTATGCTGATCTT ATGTAGAATTCCCATGGTAAACCTCTCCTTATAATAAATAGGGTAGGGTA TTAGTAAGTGGGCTACTTACACAGTGTCATCTAGCCCCGAACTAAGCTTA AGTGTACGTTACAAAAACGGATAGAGTAAGCAATATCAAACTACTAAACT AAACTAAAGTATAGAGTTTGTTTAGCTAGGGCGAGTAGAGTAAGAAGCTT TTAGCTCTACATGAGATTTGATAAAAGTTACAATGCGAGCCATTATGATC TGGTCCTGGCAAAATTTTACATGAAAATGTTTTAGATAGGATAGTATTGT CTGGGGATCGAACCTGCGATATCTGACAGTTTGGCATTCTACATTATTGA ATTGAGTAGAGACATTCGATTTGCACAGGTAATTTATGATACCTAATTGA AATTAAAATGTTTGTTTTGTCTTCGTGCTATTAATGATAGTGTTATTTTC GTTCCGGACATGCTATTTGCACTCACGATAACCTGAGGATTTTAGTGCTT ARTAATCTGGGGTAAATGCAGATACTGCAATGTTTACAGCCTTTATAGAT AGGTAAGTACCTGTTGTGACCAGGAATTTATCAGAACACTGTTCTGTCAG TCTCCGTTCTATCAGACTTTTTGTCGGCCGATAAATACTTAACATCAGGT GCGATTGTGGTCAAATAACTGCCTTGTTTTGCATAAAAAAAATAGGGCTG CTAAAAATACTCACACCGATTTGGAGTTCCTCATACCAATTAAAAGCTGA CCAAACTATCGGCTGTAGCGTCTGTGGGGAATTTTACAGAAGAGGACTTC TTATATGAAATTAAAGGCCGTAATTTATAAACAAGGAAGCTCAAATGTGC GCTTTTCAGCATAAGCTTACTTAATTACCGATTTAAAGATGAAAATCTGG TTCTGAATCGCAAGAAGATGGACAATCAAGGAGAATCCACTTCACATCAA AAACTAACAAATCTTTTAAAATCTTAAAAAACCGCTTAGCATCTAAGTTA TTTATTGATTTCCGATAACGTCCAGCAAGCAACCGCAAAAAAGTATTTAT TTTGTTGACATGGCATAGACAGACAGGTTGAGAGACTGCGCATGCAAAAA AACATAATAGATTATTAAGCAGATACAATTTATTCGGCAAATAAAATGGA TGCTTATATTTAGCATGGTAGTTYAGCGTGATTTCGATAAGTCAGTTTTA TTGTTAGTTGTTACTTACTTAGCCGCCTATTCATTCGCAGTGGGTGCTTT AACCTCGGTCACGAGAAAGCATAAAAAACAAACCTATATTTAGATTAAGA ATAAAATAATATACATTATACTTACGACGCAAAAGATGTGAAGAATAGGC AGTGAAATGAGGAAAACGGATACATTTTAAAAGTAAAGTTACGCCCATTT AGTTAATTTGTTCATTGGTTAGATAAATTCTCTTCTTCGAACCAGAGATT TTGAGTTCGAACGTACATAAATGGTGATATACCTAAAATAAGCAATAGTT AGGATATTGCTTTGAGGGAAGCTAATGAGTCTGATACCCAAGGATATTAA AATCCACATTTCAAACGATCRAATAAGACGAGTGCAAATAGCGAATAATT TTTCTTCTTCTATGAAAATAATGGTGGTGTTAAGTCAAGAATAATCCTTA TTTTGTAAAGAGAAATGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNGTCATGTTCTTCTAACTAGCTTTTCAT AAACATAGCAAATTGTAACTGTTCCGCGCATGTTCATAAGCTCGTCTTTT ATTTTTATTGGCGTGATATCTTTAGACCATAATTATAATAATGACTGTAG AATGYACTTTCCTACCAATATAATAAAGTTTTAGTATCACCAATAATAAC TTATCAATTTAATTACTTAAGAAGGTGAAGACCGTTAAATGTTTAACCGT TATACACCGTTTATCTGTTAAGCTGCGTTCTTCTCGTAAGCWATTAGTTA TTTCAAACAGATAAAGCCAAGAACAAAATATCAGTTGTCTGTCTACAGAC TGTCTGCATTATTATCCTTTATAAATCGTTTTTTATTGCGGTACCGATAA CAGATTTTCAATAACTCTTGTGGCATAAAGATAAGGTAACTTCTGAATTA TAATGATGATTATTCATATCGGCTAGACAAAGCTTCCTACTTTACTCAAT GCTTCTCAGAAAATACATCATCCTCTGAGAATATCTCAAAGCAGTTACTT ATTTAATTTATTACTGCGTTATTAAAGATTAACGAGTTCATTTGTTACAA TAACAACTTTTTATATTTATAAAATCGGTTCAATGAGGCGCAGCAATTAT TTGGAGTATCAGAAGATAATAGGTATTGCGTAGTGTTATTCAATGTTATT TTTATTACGATTCAATATTTTGTAATCTTCACCGGTAAATTTTTACAGGA AGCGTTTAAGTTATTTACTTGCCTGGATACAGTCTGGGTTAGATGATTCA CTCTTTGTTTGCGATATGAAGTTTCACTAAGATAATATGGAAGGGCGTAA ACAAGTGATGCTATGTGTGTGATGGACCATCATGACGAGAAAATGACGTC TAGAGATAAGGGGAATGTGGGTCAGATATCTTAGAAATAGCTCTGGCGGC CATCGTACTGCAAGCAGTGCATCATTAGAAATGTATTGCATTACTACGAA GTCGCTGGGACTCGGACAACTTATCAGTGCAAGCGGATGTTTTGTAATTA GGTTTCGGAGAGAAACGTGAGCTTTTAGGCGTGGACATAATATTAAAGAT TAACTAATATTTGTACATCGACTGGGAATGTGTTTACGAGCCGGTGCATT AGTCGGGAATTAGAACCAGTTTTTTAAAGATAGGCATTTTTATGAGGCCG GCGAACAGGTATAGTGATAGGCAATATTTTTCTTTGACATTTCAAAATTC TAGCGTTTCGAAATATTGCGTCAGATTAGATAGGCGCTTATTTATAAAAC TAGGTAGACTAGGTTTTACTTTAGCCTAATTGAAATGCGGGCCTGGCAGC CTACATTAACATCTCGATAAGGTAGCTGATCAAATCTAATCATAATTATC AAGATTTTAGTGTAGGCTGAAGGTTGTTCGACATCCTTTACATAGTTAAA TGGAATTAGGTGGAAGGTACGAGTAGGTAAATATACGAGTAGTATAGCAT ACAGTGATCGTTACATAATAGAACAAAGCAGTTTTCCTCATTGAACTACT ACTAAATTCTACGATGAATATGGAGAGCCTATAGAGTTTGTATCATGACG AAGAGGATAAGGACGTCACCAGTTCGCGAACTTAATCACTTTGATATCAA AGCTACAATCGATTTTCAGGGCTAGAATGAATGAATGTGTTTAAGATGTT CTCTTGGAATTTTGGATATCGGCGTCCACTACCCATTGTTGTTTTTTGTC TCCAGCCGTYTGTGGCCTGATGCTGGGAGCCCGTCTCGGGTTTCTCGAGC GTTGCATGTCGGGGCGRGCCGCGACCCTGGCTGCGGCGGTCAAGGCGCAC TTCCGAGCCCAGAGGGACTCGTATTACGGCGCGCCACTCTGGAAGTTTGC CCCCACGACCTTGTACAGAACCTTTGCGAGGAGCGAGGAGACCATTCATA CGTGAGTCATTGGACTTATCATTGGGGAATTTAAAAAAGCTTATGTTTTG TGATGCTATAAATATGGTTTAGCCGTGTGGTTCTAGCAGAGTAGAATYAG ACCATRCCCATGGATCTCATAAGAAGCGACTAAGGGAGAAATATGCGAAC ATCGGGCCTCCGCAACTTATCTGGCCAGCGTGGGTAGTGTAGGCAAAATT CTTCTTCTTTGTTAGACAAGGTCGTCCTCCTGCAATTGAGACTAAAGAAC CCGAGGTTGATGAATGATGATGACGTTATGGTAAACAGGATGACAGCAAG TTAATAAGYCAAGTTCCACTTCACCAAAATATGAAATCTCGGCAGGATAG TATCGGATCTAATGGAGGAGGCCAAGTCGCGGTGCAAGGGCGCCGCGCAG GARGACGGCATGCAAGAGATCTTCCTGAAGATCCTGGAGAACCCTGCTCT GGACATGCGGGACAAGAAAGCGGCCGTCATCGACTTCATCACAGCCGGCA TTGAGACGGTAAGTACGTATGTTAGTCGTTATTTACAGTTATACGGTTGT TTACTTTATGTTGGGAGCTAAAACAGTAAAACAAGTAAACTATTTGATAA CTGATTGCCGTTGGAATCGGAGGAAAGCATTGAATCGTATTAATCATCGG TCGTATTTAAAAACTCAAATCAATTAATATTTATTTGTTGGTTTACTTAT AAAAGATCTGTTCTGTTGCAGTTAGCAAACAGCCTAGTGTTCCTGTTATA CCTGCTAAGCGGCCGACCCGACTGGCAGGAAACTATACGTTCGGAAGTGC CTTGCAGCGGCGAGCTCAGGGCTGAGGAGATGGCTGCAGCACCGTCCATA AGGGCGGCCATCAACGAAGCCTTCAGGCTGCTACCCACCGCGCCCTTCTT GGCCAGACTTCTGGAAGCACCCATGACTGTGGCTGGACATAAGCTACCTG CTGGGGTAAGTGTCTTCAATTCAGTGGATCTTTTTCACTGTGACCCCATT TACCCCAGAGTGGCGTTATGGTTCAGCACTTGACCCATCAGGCCCCTGGC GTCAAAGGTTTTATTTATATTTTTACCTTGTTCAATTCCTTTAATATCAG GTCAATTATTTAGTCTCCACTGTAGGAGTACGGCCGTCTTCTAATTTACC GAAGGCAAATGGAGGAAGTGAAAATAATAATGATTGTATTGCAGTTTTTA TAACGATGCAATACACTCTCGCATTTCTTTGCTCTGATTTCTGCTGGATG GTTCGTTCATGATAGTGATGTTGGAAAAGTCATTGCACTGACGCAAGCTA ATGAAAGTGCATTGCACGTTCGTTAGGCACTCGGTGGAATCGTTAGTGAT TTATTAGTTGGCTTTTCAAATTGATTTATGGCATTTTAACCGCTTCTTGG TCTAGTGGTAAGACCTGATTCAGATGCAGAAGTCCCGGGTTCGATTCCCA GTGGGGGCAGAATTTTCAGTTCGGTTTAGTGGTGGTAGGGCTTGTTCTAA GGCTACCTGGATAGCTACCACCGCCTTATCTAAGTCTGCCATAACTAATC TACATTGTTATTTGTTAACAGCCTTGTTGTGTACCCGCAGTTAGAGGTAC GATAGCCAGTCCTGGTTGAGGGATCCGGGTGCAGTTCGCTTCCACCTTCG GCTTGATCATCACTTTCCATCAAATGAGATTCAGGCTAAGAGATTTTTTG TTGTGGATAAAATGTTTTTTTATTTGCTACAGACATTTGTGCTGGCTCAC ACTGGTGCTGCTTGTCGTCGTGAAGAGAACTTTTGGCGTGCGCAGGAGTA CATTCCGGAGAGATGGCTGGTCGGCAAGGAGCCTCACGCAGCGTCGCTGG TCGCGCCATTCGGACGAGGGCGGCGGATGTGCCCGGGCAAGCGATTTGTC GAGTTGGAGCTACATTTACTGCTCGCAAAGGTATATAATATTTAGAGTTC AAGTTTTGGTTCATTTACTATTTTATGCATTTTTTCTGACTCTAACAAAT GAGGTTCTCAATTAGTCTGTGTTTTTTTAAAAATGCATTGGTTTATCTTG TCCTTCTTTCTCAAAAGATTAGTTGCTATTTTTATTACCGCATTATGGTC TAATTTTTTTTATTATTTTATCCACAGATAATGCAACGTTGGAGAGTGGA ATTTGACGGGGATTTGGACGTCCAGTTTGACTTTCTGTTATCTCCCAAGT CACCGGTGTCATTGCGACTCGTCGAGTGGTAGTTACCCACTCCATTCCTA CCTCTATAGGTAGTCATAACCATACGATTAAGTGAAGAAATCGCTAGCTT ACAAGACAGACGTGCTTACTTAAATTGTACACGTTTTGAGCGAGTTCCAT TTATGTTAGCGTAATTGATATGCTCATAACGTAATGCTCATTGTATTTGA ATAGTTTTAATGTTAACTTTAATTACTATATTTAGCTATCCGCTTGGATT GAGCATGTTAAGTACCAGCTTATAGGAAACATGGGCTTTCTTTTGTACTG GAGAAAAACCTAAAACATCCGTTTAGTCCAAGCTAACTTAAAGACGMTCC AACTTCGATTATTTACTCACAAATAAGTTATAAGCATTTTCGTCTTAACC AAAGAAATATAAACAGTACTTCCGAAACACGCCTTATTAAATATAAGTAG CATGTATGTATTATTGTGTAAGTTTTTGGTCCTTCGAGCCGGATATTAAA CTCGGTTGCCATGACGGAGCTCGAGCGTGAGAGTTACAGGGTACCGGCAC TGTCTGCTCAATTTGATCACGTCTTTTTAGTTTTTAAGTGCTGTCCACAA ATTATAAGTTAAGTACGTATTTTATATTACATTTACAAAGTATCGCTAAA TTAGTGTGTAACTTTACAATATTATAAAATATGGCTGTGTTAATGTCAAA AAACGTATTTATATAAAATTATAATAAACCGAGAATACCTCTTGTTAATA AGACTGCGTACCGCCAGCATACGAGCATTTTGTCAGCATTTATAAACCAT GTATTGCAAGAGTATGTTAAGTCTTAGGTAAGGTAATATTACTATGATTA ATTGAGACATCATCTATAGTAATGTATGTGACTACTTATTTATTTAACTA TGATCATTCCCTGTAATGTTTGGTAGCATAAATAATAAGGGTATTTATGC TAGCCCGATGTAGTGGCCATTTCATATTAACTGTATGTGTTGACACAATG TACCCTCTAATATGGAGTTAGTTATATCTTTTCAACTCGTGGTATAGAAC GTGTYATTGAGTTAAAGTAAGACTTTGTAAGAATACAGATTTTAATATTT TTGTATCGCGCGCTGTCTAAAACTTAGACGCGCAGTGCCATGCATACCTC AGTGAAACCTAATGAAATGGTTGTGTAGGGTTACGAATAAAAGAAAATAC ACATGCAATTTAAAACAATTTACACAATAAAAATATGAGTGGTGTCTGTC TGGGCTTTTACGTTATTTCAATTACACGTTTTATAAATAAATTATGATTA AATGTATAAATAAAATAGGGATAAAGCATATACTCAGTGAAAACCTATTT TTATGTTCTAACCATTAAAAATCTGTATATTTTGTTTGAAAGAGATATAA TTTAATGGTATTGTTGTATGAGTTTTTATATCTCCCTCGGTGATCCTTTT CATTTCCGTTACTTTTAGTTATGGTTGAGATTTGTTTATTTTGTTCACCT TGTTTTGTATGACTAATCACATTGTTATGAATAAGTATTTTATTGTAAAT TATCTTATA
back to top

Coding sequence (CDS) from alignment at newscf_126:8111..24419+

>OSCA011725-RA ID=OSCA011725-RA|Name=OSCA011725-RA|organism=Ostrinia scapulalis|type=CDS|length=1341bp|location=Sequence derived from alignment at newscf_126:8111..24419+ (Ostrinia scapulalis)
ATAATGCAACGTTGGAGAGTGGAATTTGACGGGGATTTGGACGTCCAGTT
TGACTTTCTGTTATCTCCCAAGTCACCGGTGTCATTGCGACTCGTCGAGT
GGTAGACATTTGTGCTGGCTCACACTGGTGCTGCTTGTCGTCGTGAAGAG
AACTTTTGGCGTGCGCAGGAGTACATTCCGGAGAGATGGCTGGTCGGCAA
GGAGCCTCACGCAGCGTCGCTGGTCGCGCCATTCGGACGAGGGCGGCGGA
TGTGCCCGGGCAAGCGATTTGTCGAGTTGGAGCTACATTTACTGCTCGCA
AAGTTAGCAAACAGCCTAGTGTTCCTGTTATACCTGCTAAGCGGCCGACC
CGACTGGCAGGAAACTATACGTTCGGAAGTGCCTTGCAGCGGCGAGCTCA
GGGCTGAGGAGATGGCTGCAGCACCGTCCATAAGGGCGGCCATCAACGAA
GCCTTCAGGCTGCTACCCACCGCGCCCTTCTTGGCCAGACTTCTGGAAGC
ACCCATGACTGTGGCTGGACATAAGCTACCTGCTGGGGATAGTATCGGAT
CTAATGGAGGAGGCCAAGTCGCGGTGCAAGGGCGCCGCGCAGGARGACGG
CATGCAAGAGATCTTCCTGAAGATCCTGGAGAACCCTGCTCTGGACATGC
GGGACAAGAAAGCGGCCGTCATCGACTTCATCACAGCCGGCATTGAGACG
CCGTYTGTGGCCTGATGCTGGGAGCCCGTCTCGGGTTTCTCGAGCGTTGC
ATGTCGGGGCGRGCCGCGACCCTGGCTGCGGCGGTCAAGGCGCACTTCCG
AGCCCAGAGGGACTCGTATTACGGCGCGCCACTCTGGAAGTTTGCCCCCA
CGACCTTGTACAGAACCTTTGCGAGGAGCGAGGAGACCATTCATACACAT
GTTCAGGCGTTACGGGCCGGTGTTTGCGGAGACGACGCCAGGGGGCGCCA
TGGTGGTGTCCATAGCGGAACGGGCGGCCCAGGACCTGGACCCCGGCCCA
GAGGCCCTATCGGCCCCCCACGGAGATCGTCCAGATGCACGCTTCGTCTT
CGCCTCCCCTGGTCGACTGGTCGGGAGTTCCTACCCTGGTGCTGCTAGTG
GCTGCTGTTCTGGTGGCTGTCACCGCCTTGGTGGCTCGCGCAGCAGACGC
CAAGCACGCTGCCAGGCTGCCTGGTCCACCAGCTCTACCGTTCCTMGGAA
CGCGTTGGCTGTTCTGGAGCCGTTACAAGATGAATAAACTTCACGAAGCT
TATGAAGATGCCCTCGGTACAGCTGTTCAAGCCAGTTCAGGTCCACCGGC
CTGGAGCCTCGCTGTGCGTCACGCGCAGTGGTCGCGAAAGG
back to top
Synonyms
The feature 'OSCA011725-RA' has the following synonyms
Synonym
maker-newscf_126-snap-gene-0.19-mRNA-1