OSCA012344-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA012344-RA
Unique NameOSCA012344-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length967
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_20contignewscf_20:68837..70343 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.12
QI61|0|0|1|0|0|3|0|302
AED0.06
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA012344OSCA012344Ostrinia scapulalisgenenewscf_20 68837..70343 -


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA012344-RAOSCA012344-PAOstrinia scapulalispolypeptidenewscf_20 68837..70282 -


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA012344-RA:cdsOSCA012344-RA:cdsOstrinia scapulalisCDSnewscf_20 68837..69148 -


The following five_prime_UTR feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA012344-RA:five_prime_utrOSCA012344-RA:five_prime_utrOstrinia scapulalisfive_prime_UTRnewscf_20 70283..70343 -


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA012344-RA:exon:8OSCA012344-RA:exon:8Ostrinia scapulalisexonnewscf_20 68837..69148 -
OSCA012344-RA:exon:9OSCA012344-RA:exon:9Ostrinia scapulalisexonnewscf_20 69212..69350 -
OSCA012344-RA:exon:10OSCA012344-RA:exon:10Ostrinia scapulalisexonnewscf_20 69828..70343 -


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA012344-RA ID=OSCA012344-RA|Name=OSCA012344-RA|organism=Ostrinia scapulalis|type=mRNA|length=967bp
GATAATAAGGGCTAGCAAAAAAAGGGTTACACAACCGTGGATCTCAAAAA
CCCTACAAAATATGATAGATACGAAAGACACACTTTTCCGCAAATGGAAA
AAATGTCCAACTAACAGTAATTACCGACTAGAGTACACGNAATATCGAAA
TAAAGTTCAGAAACTGATAAATCNTGCTAAAAATAAACATAAGAGGGACG
AGCTATATAATTGTAACGGGGATCTTCGTAAAATCTGGGGTAAAATAAAT
AACTGGTTAGGTAGGAGTAATTTGTCTGTAGATACTATTATTGAAAAACA
CTTTTTAAAGGAGGAACCATCACTAAAAACAGTATGTAATAAATTTTGTG
AGACATTTACCAATGAGATCGACAACATTAAGCACAAGTGTGATAACCAG
TTCCTTGATAAAAAATCTTACATAAAGGNATGTAATGTTAGTTTTAGATA
TAAAAATGTATCAGCTGANGATGTGTGCAAAGCTATAGATAAGTTGCACT
GCAGCAAGTCACCGGGTACCTACCTGAAACATAGAACGTTAGAAGTTAAA
GTTAATGGAGTCAGTAGTGACCTAGGCAATGTTCAATATGGCGTCCCGAC
CGGGTCGGTATATGGGCCTGTTGGATACATAATTCATGTAAACAGCATGA
GCAATAACCATAGCAATATACAAAATAAAATGCAAGACGATTTTAATAAC
GTTATAAAATGGGCTCATGATAACGGCATAATAATAAATGTAAATAAAAC
TAAATGTATGCTTATAACTTCACCATACTCCCACCAAAAACAAATAAGTA
TTAATATTAAGGGTCATACGTATGAATGTCTACATAATGAAATGAAAGAT
TGTCACTGTGAACACTTGGGGCATGTATCTATGTATAAATACTTGGGACT
GACAATAGACAGTACATTCTCTTGGAAGCTACACGTGGAAAATACATGTA
TGAAGTTACGAAGCATA
back to top

protein sequence of OSCA012344-RA

>OSCA012344-PA ID=OSCA012344-PA|Name=OSCA012344-RA|organism=Ostrinia scapulalis|type=polypeptide|length=302bp
MIDTKDTLFRKWKKCPTNSNYRLEYTXYRNKVQKLINXAKNKHKRDELYN
CNGDLRKIWGKINNWLGRSNLSVDTIIEKHFLKEEPSLKTVCNKFCETFT
NEIDNIKHKCDNQFLDKKSYIKXCNVSFRYKNVSAXDVCKAIDKLHCSKS
PGTYLKHRTLEVKVNGVSSDLGNVQYGVPTGSVYGPVGYIIHVNSMSNNH
SNIQNKMQDDFNNVIKWAHDNGIIINVNKTKCMLITSPYSHQKQISINIK
GHTYECLHNEMKDCHCEHLGHVSMYKYLGLTIDSTFSWKLHVENTCMKLR
SI
back to top

mRNA from alignment at newscf_20:68837..70343-

Legend: exonfive_prime_UTRpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA012344-RA ID=OSCA012344-RA|Name=OSCA012344-RA|organism=Ostrinia scapulalis|type=mRNA|length=1507bp|location=Sequence derived from alignment at newscf_20:68837..70343- (Ostrinia scapulalis)
GATAATAAGGGCTAGCAAAAAAAGGGTTACACAACCGTGGATCTCAAAAA CCCTACAAAATATGATAGATACGAAAGACACACTTTTCCGCAAATGGAAA AAATGTCCAACTAACAGTAATTACCGACTAGAGTACACGMAATATCGAAA TAAAGTTCAGAAACTGATAAATCRTGCTAAAAATAAACATAAGAGGGACG AGCTATATAATTGTAACGGGGATCTTCGTAAAATCTGGGGTAAAATAAAT AACTGGTTAGGTAGGAGTAATTTGTCTGTAGATACTATTATTGAAAAACA CTTTTTAAAGGAGGAACCATCACTAAAAACAGTATGTAATAAATTTTGTG AGACATTTACCAATGAGATCGACAACATTAAGCACAAGTGTGATAACCAG TTCCTTGATAAAAAATCTTACATAAAGGRATGTAATGTTAGTTTTAGATA TAAAAATGTATCAGCTGARGATGTGTGCAAAGCTATAGATAAGTTGCACT GCAGCAAGTCACCGGGGTCAGATCAGATCAGGGTCAGAGACTTAAAAGAG ATCAAAAAAATAATTAGTCCTCTGATAGCAAACTTCATAAATATGTGTGT AAAAAGAGGAGTATATCCAGACGAATTAAAAAAATCAATAATAAGACCGA TTTATAAACAAGGTTTACACCAGGATTATACAAATTATAGGCCAATAGCG ATTCTTAATGTCATAAACAAAATCACTGAAAAACTTATAGTCAGTCAGAT WACAAAATTCATGGAAGACAATAATGTCCTCTCAGATATTCAACATGGAT TTAGGATCAATAGAAGTACTGCAACAGCGTTATCTAAATTTACTGACAAT GTCAACAATGCATTAAATAATAAGGAAATGGTAATGGTAATATTTATAGA TTTTAAAAAAGCTTTCGACACACTTGACCACGATGGCTTGCTGCATGCGA TGGAGGACTGTGGTATACGTGGTCCAATCAATAACTGGTTCAGTACCTAC CTGAAACATAGAACGTTAGAAGTTAAAGTTAATGGAGTCAGTAGTGACCT AGGCAATGTTCAATATGGCGTCCCGACCGGGTCGGTATATGGGCCTGTTG GATACATAATTCATGTAAACAGCATGAGCAATGTAATAAAAMACTGCAAT ACATATATGTACGCGGACGATACATGYTTAATGTTYAGCTGTAAGAACCA TAGCAATATACAAAATAAAATGCAAGACGATTTTAATAACGTTATAAAAT GGGCTCATGATAACGGCATAATAATAAATGTAAATAAAACTAAATGTATG CTTATAACTTCACCATACTCCCACCAAAAACAAATAAGTATTAATATTAA GGGTCATACGTATGAATGTCTACATAATGAAATGAAAGATTGTCACTGTG AACACTTGGGGCATGTATCTATGTATAAATACTTGGGACTGACAATAGAC AGTACATTCTCTTGGAAGCTACACGTGGAAAATACATGTATGAAGTTACG AAGCATA
back to top

Coding sequence (CDS) from alignment at newscf_20:68837..70343-

>OSCA012344-RA ID=OSCA012344-RA|Name=OSCA012344-RA|organism=Ostrinia scapulalis|type=CDS|length=906bp|location=Sequence derived from alignment at newscf_20:68837..70343- (Ostrinia scapulalis)
ATGATAGATACGAAAGACACACTTTTCCGCAAATGGAAAAAATGTCCAAC
TAACAGTAATTACCGACTAGAGTACACGMAATATCGAAATAAAGTTCAGA
AACTGATAAATCRTGCTAAAAATAAACATAAGAGGGACGAGCTATATAAT
TGTAACGGGGATCTTCGTAAAATCTGGGGTAAAATAAATAACTGGTTAGG
TAGGAGTAATTTGTCTGTAGATACTATTATTGAAAAACACTTTTTAAAGG
AGGAACCATCACTAAAAACAGTATGTAATAAATTTTGTGAGACATTTACC
AATGAGATCGACAACATTAAGCACAAGTGTGATAACCAGTTCCTTGATAA
AAAATCTTACATAAAGGRATGTAATGTTAGTTTTAGATATAAAAATGTAT
CAGCTGARGATGTGTGCAAAGCTATAGATAAGTTGCACTGCAGCAAGTCA
CCGGGTACCTACCTGAAACATAGAACGTTAGAAGTTAAAGTTAATGGAGT
CAGTAGTGACCTAGGCAATGTTCAATATGGCGTCCCGACCGGGTCGGTAT
ATGGGCCTGTTGGATACATAATTCATGTAAACAGCATGAGCAATAACCAT
AGCAATATACAAAATAAAATGCAAGACGATTTTAATAACGTTATAAAATG
GGCTCATGATAACGGCATAATAATAAATGTAAATAAAACTAAATGTATGC
TTATAACTTCACCATACTCCCACCAAAAACAAATAAGTATTAATATTAAG
GGTCATACGTATGAATGTCTACATAATGAAATGAAAGATTGTCACTGTGA
ACACTTGGGGCATGTATCTATGTATAAATACTTGGGACTGACAATAGACA
GTACATTCTCTTGGAAGCTACACGTGGAAAATACATGTATGAAGTTACGA
AGCATA
back to top
Synonyms
The feature 'OSCA012344-RA' has the following synonyms
Synonym
maker-newscf_20-snap-gene-0.12-mRNA-1