OSCA015086-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA015086-RA
Unique NameOSCA015086-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length405
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_200contignewscf_200:5035..6719 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.51
QI0|0|0|0.66|0|0|3|0|134
AED0.51
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA015086OSCA015086Ostrinia scapulalisgenenewscf_200 5035..6719 -


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA015086-RAOSCA015086-PAOstrinia scapulalispolypeptidenewscf_200 5035..6719 -


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA015086-RA:cdsOSCA015086-RA:cdsOstrinia scapulalisCDSnewscf_200 5035..5044 -


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA015086-RA:exon:623OSCA015086-RA:exon:623Ostrinia scapulalisexonnewscf_200 5035..5044 -
OSCA015086-RA:exon:624OSCA015086-RA:exon:624Ostrinia scapulalisexonnewscf_200 5352..5606 -
OSCA015086-RA:exon:625OSCA015086-RA:exon:625Ostrinia scapulalisexonnewscf_200 6580..6719 -


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA015086-RA ID=OSCA015086-RA|Name=OSCA015086-RA|organism=Ostrinia scapulalis|type=mRNA|length=405bp
ATGATCCAAACATGTAACAAAATTTTGGACAAAAGGTGGACCGACGACAT
CATAAAGGTAGCAGGAAAGCGCTGGACGCAGGCCGCTACCAACCGGGTAA
CATGGAAAGCATTGGGGGAGGCCTATGTTCAGCAGTGGACCAAGGTTCTG
GAATGGAGGCCTCGTACTGGAAAGCGCAGCGTAGGACGTCCACCCACAAG
ATGGACCGACAACCTCATAAAGGTGGCAGGAAGGCGCTGTGGAAATAATT
GGAGGAGGCCTATGTTCAGCAGTGGACGTCCTATGGCTGAAATGATGATG
ATGATGAAGTTAGACAAGGCCGTACTCTTGCAGTGGAGACTAGATGACCT
GATGATGATGATGATGATGAACCGTAAACTTAAAGTTGACAGATGCGTAG
GCTAA
back to top

protein sequence of OSCA015086-RA

>OSCA015086-PA ID=OSCA015086-PA|Name=OSCA015086-RA|organism=Ostrinia scapulalis|type=polypeptide|length=134bp
MIQTCNKILDKRWTDDIIKVAGKRWTQAATNRVTWKALGEAYVQQWTKVL
EWRPRTGKRSVGRPPTRWTDNLIKVAGRRCGNNWRRPMFSSGRPMAEMMM
MMKLDKAVLLQWRLDDLMMMMMMNRKLKVDRCVG
back to top

mRNA from alignment at newscf_200:5035..6719-

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA015086-RA ID=OSCA015086-RA|Name=OSCA015086-RA|organism=Ostrinia scapulalis|type=mRNA|length=1685bp|location=Sequence derived from alignment at newscf_200:5035..6719- (Ostrinia scapulalis)
ATGATCCAAACATGTAACAAAATTTTGGACAAAAGGTGGACCGACGACAT CATAAAGGTAGCAGGAAAGCGCTGGACGCAGGCCGCTACCAACCGGGTAA CATGGAAAGCATTGGGGGAGGCCTATGTTCAGCAGTGGACGTCCTATGGC TGAGATGATGATGATGATGATTAACAAAATTTTAGATGCTTCAGGGATGT ATAAATAAGAACAAATTAATTAATGCTGTGATTTAATTAGGACCTGAACC CATGAAAATACGAAAATTCTATGAAAATATTGATAAACGGTCGTAGTTAA TAATCTCGTGGGTAGAAGTGTAGTAAAATGAGGCAATCTACTTTTCCAAA TCTTGCTCTACATTTATCTTTAATTTAACTATCTAAATACATAATAAAGG ACATCTTTCACTTACTTGTTTCACAAAAGGCGATACCATTTTGACATGGT GACTTCAACACCACCATTTTCACACTAATATTTTGATCTTGAAACGTTTT CAATGAACAATACTACAAAGATAATTCGTTTGTTTGTACGTATGAATTTT ACACCAATTAAATTAACTAAATTACCATTACCTTACCTTCCTAATTTTGA TAACATTGTAAGCCTTATTTAGATGATCAATTAATTCATTCTAAAATTAG CAATTGAGTACAAAGAGTATCTACATGGTTAAGCCTAGGCGCAGACCACC GATTTTTAGTTGGCTGATATGGGCCCGATTTTAATTTGTATGAAGAATAG GTCGATACCAAATCGGAGTAATGTGCGCACTTTCATTTCATACCATGTCC TTATTGATTAACAGCCCGACCCAACTATCGGCCGAAAAAAGGCTGTGGTC GGCGCTTAGGCTAAAATTGGGGCGAGACCTTTGACTTTGCCCTGAAATAG GCTATTTAAATACCTGAAAAAACTTACTTTTCTTTCCTTCACTGTCATCA TTATCATCTCAGCCATAGGACGTCCACTGCTGAACATAGGGCTCCCCCAA TGCTTTCCATGTTACCCGGTTGGTAGCGGCCTGCGTCCAGCGCCTTCCTG CTACCTTTATGATGTCGTCGGTCTACCTTGCCTTCACTGACTACCTCCAA ACTGTTTGATCAGCAAGGTTCTGGAATGGAGGCCTCGTACTGGAAAGCGC AGCGTAGGACGTCCACCCACAAGATGGACCGACAACCTCATAAAGGTGGC AGGAAGGCGCTGTGGAAATAATTGGAGGAGGCCTATGTTCAGCAGTGGAC GTCCTATGGCTGAAATGATGATGATGATGAAGTTAGACAAGGCCGTACTC TTGCAGTGGAGACTAGATGACCTGATGATGATGATGATGATGAACCGTAA ACTTAAAGTTGACAGATGGTATTTTTTAAAGAAGCAGACAAAGTCACATG TAACCCTAGTCTTCCTACTACAATAACATTAAAGTGAGACGAATAGTTCT GTTCTGGTAATTTTACTATTATCTGTAAAACGGCATCTATTGTAAGCGTC TTAGAATTCAAAATACAGCGGTGTTGGTATTGTAAACAGCTATTCTGATT AGTTACACATTAATTGTGATGTATGCGAAGTAAGGTCAAAGCACCAATGA TTGACATTATCAATTTTAGAGAAAAAGCCCCAATTTGATTTTTAAAAGAA AAAATAATCATTTTTTTGGTACCAGCGTAGGCTAA
back to top

Coding sequence (CDS) from alignment at newscf_200:5035..6719-

>OSCA015086-RA ID=OSCA015086-RA|Name=OSCA015086-RA|organism=Ostrinia scapulalis|type=CDS|length=405bp|location=Sequence derived from alignment at newscf_200:5035..6719- (Ostrinia scapulalis)
ATGATCCAAACATGTAACAAAATTTTGGACAAAAGGTGGACCGACGACAT
CATAAAGGTAGCAGGAAAGCGCTGGACGCAGGCCGCTACCAACCGGGTAA
CATGGAAAGCATTGGGGGAGGCCTATGTTCAGCAGTGGACCAAGGTTCTG
GAATGGAGGCCTCGTACTGGAAAGCGCAGCGTAGGACGTCCACCCACAAG
ATGGACCGACAACCTCATAAAGGTGGCAGGAAGGCGCTGTGGAAATAATT
GGAGGAGGCCTATGTTCAGCAGTGGACGTCCTATGGCTGAAATGATGATG
ATGATGAAGTTAGACAAGGCCGTACTCTTGCAGTGGAGACTAGATGACCT
GATGATGATGATGATGATGAACCGTAAACTTAAAGTTGACAGATGCGTAG
GCTAA
back to top
Synonyms
The feature 'OSCA015086-RA' has the following synonyms
Synonym
maker-newscf_200-snap-gene-0.8-mRNA-1