OSCA022928-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA022928-RA
Unique NameOSCA022928-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length291
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_2001contignewscf_2001:60..963 +
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.29
QI0|0|0|0.5|1|1|2|0|96
AED0.26
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA022928OSCA022928Ostrinia scapulalisgenenewscf_2001 60..963 +


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA022928-RAOSCA022928-PAOstrinia scapulalispolypeptidenewscf_2001 60..963 +


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA022928-RA:exon:678OSCA022928-RA:exon:678Ostrinia scapulalisexonnewscf_2001 60..206 +
OSCA022928-RA:exon:679OSCA022928-RA:exon:679Ostrinia scapulalisexonnewscf_2001 820..963 +


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA022928-RA:cdsOSCA022928-RA:cdsOstrinia scapulalisCDSnewscf_2001 820..963 +


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA022928-RA ID=OSCA022928-RA|Name=OSCA022928-RA|organism=Ostrinia scapulalis|type=mRNA|length=291bp
ATGTATTTTCTAACAGTCTTTAATATGTATTTATCCAAATGTTGTTGTCC
TCAGGTAGCGAACCTGGTGTGCTCGATGTCAAACAACGAGGACGGCGTCA
AGATGGTGCGCCACGCCGCCTCGCAGATCGAGGCTCTGTGTCCGCAGCCG
AAAGACGTCCACTGCTGGACAAAGGCCTTCCCCAAAGGTTTCCACAAAGA
CCGGTCCTGCGCTGCCCGCATTCAGGCACCTCCCACGACCTTTACCAAAC
CGTCGGTCCACATAGTGGACCCCCTGTCGTGTTCAATCTAA
back to top

protein sequence of OSCA022928-RA

>OSCA022928-PA ID=OSCA022928-PA|Name=OSCA022928-RA|organism=Ostrinia scapulalis|type=polypeptide|length=96bp
MYFLTVFNMYLSKCCCPQVANLVCSMSNNEDGVKMVRHAASQIEALCPQP
KDVHCWTKAFPKGFHKDRSCAARIQAPPTTFTKPSVHIVDPLSCSI
back to top

mRNA from alignment at newscf_2001:60..963+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA022928-RA ID=OSCA022928-RA|Name=OSCA022928-RA|organism=Ostrinia scapulalis|type=mRNA|length=904bp|location=Sequence derived from alignment at newscf_2001:60..963+ (Ostrinia scapulalis)
ATGTATTTTCTAACAGTCTTTAATATGTATTTATCCAAATGTTGTTGTCC TCAGGTAGCGAACCTGGTGTGCTCGATGTCAAACAACGAGGACGGCGTCA AGATGGTGCGCCACGCCGCCTCGCAGATCGAGGCTCTGTGTCCGCAGGTC AGACACCACTCTTTTGTAGCCTTTCCCAAGCCAGTGGGCTTAGTGCGAAT TTACACCATACGTCATCGCTAGCGACTGCGTAAAATATGGCATCAAATGT ACATGTCAACGTGAAATTGTCAGTTTATAATATAACGCGTTAGATTGTAA ACTAACAGTGGGTTACGTTAGGTTAGATTGTAATTTACCTACGTCAGATT ATAATCTGACGGAATTCACAATTTTACGGTGACATACACATTGTACAGCG TCCCAAGCGGATACTTTCAAGAACTAAAATCTTCATAGATTTTTTTAACA CTCGCTAGCATGACGTTCAATGGAAACTCGCTGTACGCCAATCGCGAACA ACTCTTGTAGTCGTAGAGCTGTTATCATGACGAATTGTTTGCTGTCACAA GAGAAACATTTTGGTTATTTATTTGCATTTGCATTAATAAACGGTAAAAA TATATCTTTCGACAAAAGCTACTAACACTCTTTCCCTGCTATATTATTCG TCTTTCAATTTCATTTGTCTCCTACCGTGTCCCATTCTAATATGTCCCTT TCATCATTAGTCAATTAGCCTTTATTTGTCCCCTGTCGCTCGATCGTCCG TTCGTTTCAGCCGAAAGACGTCCACTGCTGGACAAAGGCCTTCCCCAAAG GTTTCCACAAAGACCGGTCCTGCGCTGCCCGCATTCAGGCACCTCCCACG ACCTTTACCAAACCGTCGGTCCACATAGTGGACCCCCTGTCGTGTTCAAT CTAA
back to top

Coding sequence (CDS) from alignment at newscf_2001:60..963+

>OSCA022928-RA ID=OSCA022928-RA|Name=OSCA022928-RA|organism=Ostrinia scapulalis|type=CDS|length=291bp|location=Sequence derived from alignment at newscf_2001:60..963+ (Ostrinia scapulalis)
CCGAAAGACGTCCACTGCTGGACAAAGGCCTTCCCCAAAGGTTTCCACAA
AGACCGGTCCTGCGCTGCCCGCATTCAGGCACCTCCCACGACCTTTACCA
AACCGTCGGTCCACATAGTGGACCCCCTGTCGTGTTCAATCTAAATGTAT
TTTCTAACAGTCTTTAATATGTATTTATCCAAATGTTGTTGTCCTCAGGT
AGCGAACCTGGTGTGCTCGATGTCAAACAACGAGGACGGCGTCAAGATGG
TGCGCCACGCCGCCTCGCAGATCGAGGCTCTGTGTCCGCAG
back to top
Synonyms
The feature 'OSCA022928-RA' has the following synonyms
Synonym
maker-newscf_2001-augustus-gene-0.3-mRNA-1