OSCA024044-RA (mRNA) Ostrinia scapulalis

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameOSCA024044-RA
Unique NameOSCA024044-RA
TypemRNA
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length360
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_25216contignewscf_25216:1513..1926 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Properties
Property NameValue
eAED0.19
QI0|0|0|1|1|1|2|0|120
AED0.19
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA024044OSCA024044Ostrinia scapulalisgenenewscf_25216 1513..1926 -


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA024044-RAOSCA024044-PAOstrinia scapulalispolypeptidenewscf_25216 1513..1926 -


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA024044-RA:cdsOSCA024044-RA:cdsOstrinia scapulalisCDSnewscf_25216 1513..1848 -


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
OSCA024044-RA:exon:2803OSCA024044-RA:exon:2803Ostrinia scapulalisexonnewscf_25216 1513..1848 -
OSCA024044-RA:exon:2804OSCA024044-RA:exon:2804Ostrinia scapulalisexonnewscf_25216 1903..1926 -


Sequences
The following sequences are available for this feature:

mRNA sequence

>OSCA024044-RA ID=OSCA024044-RA|Name=OSCA024044-RA|organism=Ostrinia scapulalis|type=mRNA|length=360bp
ATGGGCCTCATAAGAAGGCTCAAGGTCCGCAGGTCAATCGAGATTCGCAG
GAGAATCAAAGTGACTGACATAGCCCGCGGAATCGCTAAAATGAAGTGGC
AGTGGGCGGGGCACATAGCTCGTAGAGCTGATGGCCGCTGGGGCAGAAAA
GTTCTCGAGTGGCGACCACGAGCCGGAAGACGTAGTGTGGGCAGGCCTTT
CACTAGGTGGACCGACGATCTGGTGAAAGTCGCGGGCGGTGCAGGACCGG
TCTTTATGGAAAACCTTGGGGGAGGCCTTTGTCCAGCAGTGGACGTCTTT
CGGCTGAAACGAACGAACGAACGAACTAATGTAATAAACGCGAATGTTGG
TGAGGATCGA
back to top

protein sequence of OSCA024044-RA

>OSCA024044-PA ID=OSCA024044-PA|Name=OSCA024044-RA|organism=Ostrinia scapulalis|type=polypeptide|length=120bp
MGLIRRLKVRRSIEIRRRIKVTDIARGIAKMKWQWAGHIARRADGRWGRK
VLEWRPRAGRRSVGRPFTRWTDDLVKVAGGAGPVFMENLGGGLCPAVDVF
RLKRTNERTNVINANVGEDR
back to top

mRNA from alignment at newscf_25216:1513..1926-

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>OSCA024044-RA ID=OSCA024044-RA|Name=OSCA024044-RA|organism=Ostrinia scapulalis|type=mRNA|length=414bp|location=Sequence derived from alignment at newscf_25216:1513..1926- (Ostrinia scapulalis)
ATGGGCCTCATAAGAAGGCTCAAGGTCAGGGGCGATGGAGCGTGCTATGC TCGGAGTTTCCCTTTGTGATCAAATCAGGTCCGCAGGTCAATCGAGATTC GCAGGAGAATCAAAGTGACTGACATAGCCCGCGGAATCGCTAAAATGAAG TGGCAGTGGGCGGGGCACATAGCTCGTAGAGCTGATGGCCGCTGGGGCAG AAAAGTTCTCGAGTGGCGACCACGAGCCGGAAGACGTAGTGTGGGCAGGC CTTTCACTAGGTGGACCGACGATCTGGTGAAAGTCGCGGGCGGTGCAGGA CCGGTCTTTATGGAAAACCTTGGGGGAGGCCTTTGTCCAGCAGTGGACGT CTTTCGGCTGAAACGAACGAACGAACGAACTAATGTAATAAACGCGAATG TTGGTGAGGATCGA
back to top

Coding sequence (CDS) from alignment at newscf_25216:1513..1926-

>OSCA024044-RA ID=OSCA024044-RA|Name=OSCA024044-RA|organism=Ostrinia scapulalis|type=CDS|length=360bp|location=Sequence derived from alignment at newscf_25216:1513..1926- (Ostrinia scapulalis)
ATGGGCCTCATAAGAAGGCTCAAGGTCCGCAGGTCAATCGAGATTCGCAG
GAGAATCAAAGTGACTGACATAGCCCGCGGAATCGCTAAAATGAAGTGGC
AGTGGGCGGGGCACATAGCTCGTAGAGCTGATGGCCGCTGGGGCAGAAAA
GTTCTCGAGTGGCGACCACGAGCCGGAAGACGTAGTGTGGGCAGGCCTTT
CACTAGGTGGACCGACGATCTGGTGAAAGTCGCGGGCGGTGCAGGACCGG
TCTTTATGGAAAACCTTGGGGGAGGCCTTTGTCCAGCAGTGGACGTCTTT
CGGCTGAAACGAACGAACGAACGAACTAATGTAATAAACGCGAATGTTGG
TGAGGATCGA
back to top
Synonyms
The feature 'OSCA024044-RA' has the following synonyms
Synonym
augustus-newscf_25216-processed-gene-0.0-mRNA-1