HiSeq10001_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq10001
Unique NameHiSeq10001_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length175
Homology
BLAST of HiSeq10001 vs. genbank:protein
Match: gi|914575299|gb|KOB77416.1| (Pre-mrna processing factor, partial [Operophtera brumata])

HSP 1 Score: 85.8853 bits (211), Expect = 2.160e-16
Identity = 54/139 (38.85%), Postives = 74/139 (53.24%), Query Frame = 0
Query:   34 QGFVVPYPYQDQLQEQ--VVLKPLYSEVIVPAVPALPATAVVSEVAEVGFSKLGLITKAASFALGLVKTAVFFVIAKAPALILGTLAAFGICKFTPICSKLSSVESLYEVPIELRSYATPERLAKATEFVKKAIRKYRS 170
            Q +  PYPY     +Q  ++++P+   +       LP T       EV  S  GL T  A      VK A  F++  APALI GT+ A G+CK T +C    S  ++ E   ELRS ATPER+A  T+FVK+A+RKY +
Sbjct:   39 QAYSFPYPYHGSRNKQHHMLMEPMEPPIYTHGDVILPPTT------EVVVSSPGLCTYQA------VKAAAIFLLYNAPALIAGTVIALGVCKMTSLCG---SQLTIIEAQRELRSIATPERIASVTDFVKEAVRKYNA 162          
BLAST of HiSeq10001 vs. genbank:protein
Match: gi|768449099|ref|XP_011566618.1| (PREDICTED: uncharacterized protein LOC105396321 [Plutella xylostella])

HSP 1 Score: 70.8626 bits (172), Expect = 2.718e-12
Identity = 40/102 (39.22%), Postives = 61/102 (59.80%), Query Frame = 0
Query:   76 VAEVGFSK----LGLITKAASFALGLVKTAVFFVIAKAPALILGTLAAFGICKFTPICSKLSSVESLYEVPIELRSYATPERLAKATEFVKKAIRKYRSLQE 173
            VA  G SK     G+++   S    + K    F+I+  P LILG   A GICK TPIC++L  + +      ++RS A+PERL +AT+FV++AI K+ ++Q+
Sbjct:   64 VAGEGVSKHSLGFGVVSAVTSKIYAIGKYITTFIISSLPQLILGGAIAVGICKLTPICTQLEHITAE-----DVRSLASPERLTRATKFVEQAIEKFTAMQD 160          
BLAST of HiSeq10001 vs. genbank:protein
Match: gi|768418623|ref|XP_011550006.1| (PREDICTED: uncharacterized protein LOC105381899 [Plutella xylostella])

HSP 1 Score: 68.5514 bits (166), Expect = 1.899e-11
Identity = 39/102 (38.24%), Postives = 60/102 (58.82%), Query Frame = 0
Query:   76 VAEVGFSK----LGLITKAASFALGLVKTAVFFVIAKAPALILGTLAAFGICKFTPICSKLSSVESLYEVPIELRSYATPERLAKATEFVKKAIRKYRSLQE 173
            VA  G SK     G+++   S    + K    F+I+  P LILG   A GICK TPIC++L  + +      ++RS A+PERL +A +FV++AI K+ ++Q+
Sbjct:   64 VAGEGVSKHSLGFGVVSAVTSKIYAIGKYITTFIISSLPQLILGGAIAVGICKLTPICTQLEHITAE-----DVRSLASPERLTRAAKFVEQAIDKFTAMQD 160          
The following BLAST results are available for this feature:
BLAST of HiSeq10001 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 3
Match NameE-valueIdentityDescription
gi|914575299|gb|KOB77416.1|2.160e-1638.85Pre-mrna processing factor, partial [Operophtera b... [more]
gi|768449099|ref|XP_011566618.1|2.718e-1239.22PREDICTED: uncharacterized protein LOC105396321 [P... [more]
gi|768418623|ref|XP_011550006.1|1.899e-1138.24PREDICTED: uncharacterized protein LOC105381899 [P... [more]
back to top
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 154..175
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_H_REGIONSignal peptide H-regioncoord: 7..18
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 24..175
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_N_REGIONSignal peptide N-regioncoord: 1..6
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDESignal Peptidecoord: 1..23
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_C_REGIONSignal peptide C-regioncoord: 19..23
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..23
score: 0.775
NoneNo IPR availableTMHMMTMhelixcoord: 100..122
NoneNo IPR availableTMHMMTMhelixcoord: 7..24

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq10001HiSeq10001Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq10001_p ID=HiSeq10001_p|Name=HiSeq10001|organism=Ostrinia scapulalis|type=polypeptide|length=175bp
MARSGSLXVVLWAISFLAXXILSFKHHTNQIFFQGFVVPYPYQDQLQEQV
VLKPLYSEVIVPAVPALPATAVVSEVAEVGFSKLGLITKAASFALGLVKT
AVFFVIAKAPALILGTLAAFGICKFTPICSKLSSVESLYEVPIELRSYAT
PERLAKATEFVKKAIRKYRSLQEEH
back to top