HiSeq10002_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq10002
Unique NameHiSeq10002_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length178
Homology
BLAST of HiSeq10002 vs. genbank:protein
Match: gi|914575299|gb|KOB77416.1| (Pre-mrna processing factor, partial [Operophtera brumata])

HSP 1 Score: 94.3597 bits (233), Expect = 2.874e-19
Identity = 68/184 (36.96%), Postives = 94/184 (51.09%), Query Frame = 0
Query:    1 MFKAVFVCVILIVATSATHYEDLELNNLIEY---GESPYGGFVVPYPYQ--DQLQEQVVLKPL------YSEVIVPAVPALPATAVVSEVAEVGFSKLGLITKAASFALGLVKTAVFFVIAKAPALILGTLAAFGICKFTPICSKLSSVESLYEVPIELRSYATPERLAKATEFVKKAIRKYRS 173
            M K   V  +L+    + +  DL+ NNLIEY      P   +  PYPY      Q  ++++P+      + +VI+P     P T VV        S  GL T  A      VK A  F++  APALI GT+ A G+CK T +C    S  ++ E   ELRS ATPER+A  T+FVK+A+RKY +
Sbjct:    1 MLKTAIVGSMLLAVALSGYVTDLD-NNLIEYELEDVQPMQAYSFPYPYHGSRNKQHHMLMEPMEPPIYTHGDVILP-----PTTEVV-------VSSPGLCTYQA------VKAAAIFLLYNAPALIAGTVIALGVCKMTSLCG---SQLTIIEAQRELRSIATPERIASVTDFVKEAVRKYNA 162          
BLAST of HiSeq10002 vs. genbank:protein
Match: gi|768449099|ref|XP_011566618.1| (PREDICTED: uncharacterized protein LOC105396321 [Plutella xylostella])

HSP 1 Score: 72.0182 bits (175), Expect = 1.057e-12
Identity = 54/175 (30.86%), Postives = 89/175 (50.86%), Query Frame = 0
Query:    5 VFVCVILIVATSATHYEDLELNNLIEYGES---PYGGFVVPYPYQDQLQEQVVLKPLYSEVIVPAVPALPATAVVSEVAEVGFSKLGLITKAASFALGLVKTAVFFVIAKAPALILGTLAAFGICKFTPICSKLSSVESLYEVPIELRSYATPERLAKATEFVKKAIRKYRSLQE 176
            +F   +L VAT+  +       N+ E+ +    P     +P+ YQ  L+++       S       P   A   VS+   +GF   G+++   S    + K    F+I+  P LILG   A GICK TPIC++L  + +      ++RS A+PERL +AT+FV++AI K+ ++Q+
Sbjct:    6 IFGAALLAVATAQAN------ENIAEFKDGFMVPVQNGAIPFVYQSALRKRFAEAEHRS-----LTPVSVAGEGVSK-HSLGF---GVVSAVTSKIYAIGKYITTFIISSLPQLILGGAIAVGICKLTPICTQLEHITAE-----DVRSLASPERLTRATKFVEQAIEKFTAMQD 160          
BLAST of HiSeq10002 vs. genbank:protein
Match: gi|768418623|ref|XP_011550006.1| (PREDICTED: uncharacterized protein LOC105381899 [Plutella xylostella])

HSP 1 Score: 68.5514 bits (166), Expect = 2.470e-11
Identity = 53/175 (30.29%), Postives = 87/175 (49.71%), Query Frame = 0
Query:    5 VFVCVILIVATSATHYEDLELNNLIEYGES---PYGGFVVPYPYQDQLQEQVVLKPLYSEVIVPAVPALPATAVVSEVAEVGFSKLGLITKAASFALGLVKTAVFFVIAKAPALILGTLAAFGICKFTPICSKLSSVESLYEVPIELRSYATPERLAKATEFVKKAIRKYRSLQE 176
            +F   +L VAT   +       N+ E+ +    P     +P+ YQ  L+++       S       P   A   VS+   +GF   G+++   S    + K    F+I+  P LILG   A GICK TPIC++L  + +      ++RS A+PERL +A +FV++AI K+ ++Q+
Sbjct:    6 IFGAALLAVATVQAN------ENIAEFKDGFMVPVQNGAIPFVYQSALRKRFAEAEHRS-----LTPVSVAGEGVSK-HSLGF---GVVSAVTSKIYAIGKYITTFIISSLPQLILGGAIAVGICKLTPICTQLEHITAE-----DVRSLASPERLTRAAKFVEQAIDKFTAMQD 160          
The following BLAST results are available for this feature:
BLAST of HiSeq10002 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 3
Match NameE-valueIdentityDescription
gi|914575299|gb|KOB77416.1|2.874e-1936.96Pre-mrna processing factor, partial [Operophtera b... [more]
gi|768449099|ref|XP_011566618.1|1.057e-1230.86PREDICTED: uncharacterized protein LOC105396321 [P... [more]
gi|768418623|ref|XP_011550006.1|2.470e-1130.29PREDICTED: uncharacterized protein LOC105381899 [P... [more]
back to top
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 157..178
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 18..178
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_N_REGIONSignal peptide N-regioncoord: 1..3
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_C_REGIONSignal peptide C-regioncoord: 13..17
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDE_H_REGIONSignal peptide H-regioncoord: 4..12
NoneNo IPR availablePHOBIUSSIGNAL_PEPTIDESignal Peptidecoord: 1..17
NoneNo IPR availableSIGNALP_GRAM_NEGATIVESignalP-noTMSignalP-noTMcoord: 1..19
score: 0.617
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..17
score: 0.77
NoneNo IPR availableTMHMMTMhelixcoord: 103..125

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq10002HiSeq10002Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq10002_p ID=HiSeq10002_p|Name=HiSeq10002|organism=Ostrinia scapulalis|type=polypeptide|length=178bp
MFKAVFVCVILIVATSATHYEDLELNNLIEYGESPYGGFVVPYPYQDQLQ
EQVVLKPLYSEVIVPAVPALPATAVVSEVAEVGFSKLGLITKAASFALGL
VKTAVFFVIAKAPALILGTLAAFGICKFTPICSKLSSVESLYEVPIELRS
YATPERLAKATEFVKKAIRKYRSLQEEH
back to top