HiSeq1000_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq1000
Unique NameHiSeq1000_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length70
Homology
BLAST of HiSeq1000 vs. genbank:protein
Match: gi|827553994|ref|XP_012548620.1| (PREDICTED: Down syndrome cell adhesion molecule-like protein Dscam2 isoform X13 [Bombyx mori])

HSP 1 Score: 129.028 bits (323), Expect = 3.605e-33
Identity = 59/70 (84.29%), Postives = 65/70 (92.86%), Query Frame = 0
Query:    1 DVNVRAVVQQQYESEVNNEYVIRGNSAILKCSIPSFVADFVTVVSWHDEEGNSIALDGSKAGDDGKYLVL 70
            DVNVRAVVQQQYESEVNNEYVIRGNSAILKCSIPSFVADFVTV+SWHD+ GN+  ++ SK G+DGKYLVL
Sbjct:  118 DVNVRAVVQQQYESEVNNEYVIRGNSAILKCSIPSFVADFVTVLSWHDDTGNTFTIEESKEGEDGKYLVL 187          
BLAST of HiSeq1000 vs. genbank:protein
Match: gi|15127904|gb|AAK84346.1| (DSCAM splice variant 4.4, partial [Drosophila yakuba])

HSP 1 Score: 107.842 bits (268), Expect = 8.794e-28
Identity = 53/70 (75.71%), Postives = 58/70 (82.86%), Query Frame = 0
Query:    1 DVNVRAVVQQQYESEVNNEYVIRGNSAILKCSIPSFVADFVTVVSWHDEEGNSIALDGSKAGDDGKYLVL 70
            DV+VRAVVQQ +ESEVNNEYVIRGN+A+LKCSIPSFVADFV VVSW DEEG      G + G DGKYLVL
Sbjct:   97 DVHVRAVVQQFHESEVNNEYVIRGNAAVLKCSIPSFVADFVQVVSWQDEEGQLYGSLGDQQGTDGKYLVL 166          
BLAST of HiSeq1000 vs. genbank:protein
Match: gi|1036884636|ref|XP_017093509.1| (PREDICTED: Down syndrome cell adhesion molecule-like protein Dscam2 isoform X29 [Drosophila bipectinata])

HSP 1 Score: 112.849 bits (281), Expect = 1.943e-27
Identity = 54/70 (77.14%), Postives = 58/70 (82.86%), Query Frame = 0
Query:    1 DVNVRAVVQQQYESEVNNEYVIRGNSAILKCSIPSFVADFVTVVSWHDEEGNSIALDGSKAGDDGKYLVL 70
            DV+VRAVVQQ YESEVNNEYVIRGN+A+LKCSIPSFVADFV VVSW DEEG      G + G DGKYLVL
Sbjct:  134 DVHVRAVVQQFYESEVNNEYVIRGNAAVLKCSIPSFVADFVQVVSWQDEEGQLYGTLGEQQGSDGKYLVL 203          
BLAST of HiSeq1000 vs. genbank:protein
Match: gi|1036884547|ref|XP_017093504.1| (PREDICTED: Down syndrome cell adhesion molecule-like protein Dscam2 isoform X25 [Drosophila bipectinata])

HSP 1 Score: 112.849 bits (281), Expect = 1.981e-27
Identity = 54/70 (77.14%), Postives = 58/70 (82.86%), Query Frame = 0
Query:    1 DVNVRAVVQQQYESEVNNEYVIRGNSAILKCSIPSFVADFVTVVSWHDEEGNSIALDGSKAGDDGKYLVL 70
            DV+VRAVVQQ YESEVNNEYVIRGN+A+LKCSIPSFVADFV VVSW DEEG      G + G DGKYLVL
Sbjct:  134 DVHVRAVVQQFYESEVNNEYVIRGNAAVLKCSIPSFVADFVQVVSWQDEEGQLYGTLGEQQGSDGKYLVL 203          
BLAST of HiSeq1000 vs. genbank:protein
Match: gi|1036956015|ref|XP_017146793.1| (PREDICTED: Down syndrome cell adhesion molecule-like protein Dscam2 isoform X37 [Drosophila miranda])

HSP 1 Score: 112.464 bits (280), Expect = 2.383e-27
Identity = 54/70 (77.14%), Postives = 58/70 (82.86%), Query Frame = 0
Query:    1 DVNVRAVVQQQYESEVNNEYVIRGNSAILKCSIPSFVADFVTVVSWHDEEGNSIALDGSKAGDDGKYLVL 70
            DV+VRAVVQQ YESEVNNEYVIRGN+A+LKCSIPSFVADFV VVSW DEEG      G + G DGKYLVL
Sbjct:  134 DVHVRAVVQQFYESEVNNEYVIRGNAAVLKCSIPSFVADFVQVVSWQDEEGQLYGTLGEQQGADGKYLVL 203          
BLAST of HiSeq1000 vs. genbank:protein
Match: gi|969488205|ref|XP_015039105.1| (dscam, isoform D [Drosophila pseudoobscura pseudoobscura] >gi|950767521|gb|KRT01543.1| dscam, isoform D [Drosophila pseudoobscura pseudoobscura])

HSP 1 Score: 112.464 bits (280), Expect = 2.383e-27
Identity = 54/70 (77.14%), Postives = 58/70 (82.86%), Query Frame = 0
Query:    1 DVNVRAVVQQQYESEVNNEYVIRGNSAILKCSIPSFVADFVTVVSWHDEEGNSIALDGSKAGDDGKYLVL 70
            DV+VRAVVQQ YESEVNNEYVIRGN+A+LKCSIPSFVADFV VVSW DEEG      G + G DGKYLVL
Sbjct:  134 DVHVRAVVQQFYESEVNNEYVIRGNAAVLKCSIPSFVADFVQVVSWQDEEGQLYGTLGEQQGADGKYLVL 203          
BLAST of HiSeq1000 vs. genbank:protein
Match: gi|1036955979|ref|XP_017146791.1| (PREDICTED: Down syndrome cell adhesion molecule-like protein Dscam2 isoform X35 [Drosophila miranda])

HSP 1 Score: 112.464 bits (280), Expect = 2.600e-27
Identity = 54/70 (77.14%), Postives = 58/70 (82.86%), Query Frame = 0
Query:    1 DVNVRAVVQQQYESEVNNEYVIRGNSAILKCSIPSFVADFVTVVSWHDEEGNSIALDGSKAGDDGKYLVL 70
            DV+VRAVVQQ YESEVNNEYVIRGN+A+LKCSIPSFVADFV VVSW DEEG      G + G DGKYLVL
Sbjct:  134 DVHVRAVVQQFYESEVNNEYVIRGNAAVLKCSIPSFVADFVQVVSWQDEEGQLYGTLGEQQGADGKYLVL 203          
BLAST of HiSeq1000 vs. genbank:protein
Match: gi|1036955780|ref|XP_017146779.1| (PREDICTED: Down syndrome cell adhesion molecule-like protein Dscam2 isoform X24 [Drosophila miranda])

HSP 1 Score: 112.464 bits (280), Expect = 2.600e-27
Identity = 54/70 (77.14%), Postives = 58/70 (82.86%), Query Frame = 0
Query:    1 DVNVRAVVQQQYESEVNNEYVIRGNSAILKCSIPSFVADFVTVVSWHDEEGNSIALDGSKAGDDGKYLVL 70
            DV+VRAVVQQ YESEVNNEYVIRGN+A+LKCSIPSFVADFV VVSW DEEG      G + G DGKYLVL
Sbjct:  134 DVHVRAVVQQFYESEVNNEYVIRGNAAVLKCSIPSFVADFVQVVSWQDEEGQLYGTLGEQQGADGKYLVL 203          
BLAST of HiSeq1000 vs. genbank:protein
Match: gi|1036955746|ref|XP_017146777.1| (PREDICTED: Down syndrome cell adhesion molecule-like protein Dscam2 isoform X22 [Drosophila miranda])

HSP 1 Score: 112.079 bits (279), Expect = 2.894e-27
Identity = 54/70 (77.14%), Postives = 58/70 (82.86%), Query Frame = 0
Query:    1 DVNVRAVVQQQYESEVNNEYVIRGNSAILKCSIPSFVADFVTVVSWHDEEGNSIALDGSKAGDDGKYLVL 70
            DV+VRAVVQQ YESEVNNEYVIRGN+A+LKCSIPSFVADFV VVSW DEEG      G + G DGKYLVL
Sbjct:  134 DVHVRAVVQQFYESEVNNEYVIRGNAAVLKCSIPSFVADFVQVVSWQDEEGQLYGTLGEQQGADGKYLVL 203          
BLAST of HiSeq1000 vs. genbank:protein
Match: gi|1036955445|ref|XP_017146757.1| (PREDICTED: Down syndrome cell adhesion molecule-like protein Dscam2 isoform X4 [Drosophila miranda])

HSP 1 Score: 112.079 bits (279), Expect = 2.894e-27
Identity = 54/70 (77.14%), Postives = 58/70 (82.86%), Query Frame = 0
Query:    1 DVNVRAVVQQQYESEVNNEYVIRGNSAILKCSIPSFVADFVTVVSWHDEEGNSIALDGSKAGDDGKYLVL 70
            DV+VRAVVQQ YESEVNNEYVIRGN+A+LKCSIPSFVADFV VVSW DEEG      G + G DGKYLVL
Sbjct:  134 DVHVRAVVQQFYESEVNNEYVIRGNAAVLKCSIPSFVADFVQVVSWQDEEGQLYGTLGEQQGADGKYLVL 203          
The following BLAST results are available for this feature:
BLAST of HiSeq1000 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|827553994|ref|XP_012548620.1|3.605e-3384.29PREDICTED: Down syndrome cell adhesion molecule-li... [more]
gi|15127904|gb|AAK84346.1|8.794e-2875.71DSCAM splice variant 4.4, partial [Drosophila yaku... [more]
gi|1036884636|ref|XP_017093509.1|1.943e-2777.14PREDICTED: Down syndrome cell adhesion molecule-li... [more]
gi|1036884547|ref|XP_017093504.1|1.981e-2777.14PREDICTED: Down syndrome cell adhesion molecule-li... [more]
gi|1036956015|ref|XP_017146793.1|2.383e-2777.14PREDICTED: Down syndrome cell adhesion molecule-li... [more]
gi|969488205|ref|XP_015039105.1|2.383e-2777.14dscam, isoform D [Drosophila pseudoobscura pseudoo... [more]
gi|1036955979|ref|XP_017146791.1|2.600e-2777.14PREDICTED: Down syndrome cell adhesion molecule-li... [more]
gi|1036955780|ref|XP_017146779.1|2.600e-2777.14PREDICTED: Down syndrome cell adhesion molecule-li... [more]
gi|1036955746|ref|XP_017146777.1|2.894e-2777.14PREDICTED: Down syndrome cell adhesion molecule-li... [more]
gi|1036955445|ref|XP_017146757.1|2.894e-2777.14PREDICTED: Down syndrome cell adhesion molecule-li... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0016021 integral component of membrane
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR10489CELL ADHESION MOLECULEcoord: 1..70
NoneNo IPR availablePANTHERPTHR10489:SF567DOWN SYNDROME CELL ADHESION MOLECULE, ISOFORM ANcoord: 1..70

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq1000HiSeq1000Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq1000_p ID=HiSeq1000_p|Name=HiSeq1000|organism=Ostrinia scapulalis|type=polypeptide|length=70bp
DVNVRAVVQQQYESEVNNEYVIRGNSAILKCSIPSFVADFVTVVSWHDEE
GNSIALDGSKAGDDGKYLVL
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane