HiSeq10016_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq10016
Unique NameHiSeq10016_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length187
Homology
BLAST of HiSeq10016 vs. genbank:protein
Match: gi|827543663|ref|XP_012544718.1| (PREDICTED: protein phosphatase Slingshot [Bombyx mori])

HSP 1 Score: 175.637 bits (444), Expect = 2.101e-47
Identity = 99/173 (57.23%), Postives = 113/173 (65.32%), Query Frame = 0
Query:   29 AGLVSNLKKEFEARSEAEAARRGK-----APREAAG----------DLSVRLLVDQYEPTGGAR---------------------RSRPETRAR-----VRNSFCGAVRGAGGERPPPAPTVVSLAPLDYSDVVVSTVMSKAQNKKQLQHGKTHPLTRLNLNRSSNRCSNPVY 160
            AGLVSNLKKEFEARSE +  RR +     A  E A           DLSV++LVD+Y+  G +R                      S   TR R     +RNSFCGA RG G +RPPPAPTV++LAP+DY+DVVVSTVMSKAQNKKQLQHGKTHPLTRLNLNRS+NRCSNPVY
Sbjct:  863 AGLVSNLKKEFEARSETDTLRRSEPRTRTAANEHADRSPASPPSGEDLSVKVLVDRYDRPGRSRSESVGTKGPQESVSKKCRLTAESESRTRTRSGAVALRNSFCGAFRGLGADRPPPAPTVLALAPIDYNDVVVSTVMSKAQNKKQLQHGKTHPLTRLNLNRSNNRCSNPVY 1035          
BLAST of HiSeq10016 vs. genbank:protein
Match: gi|930649154|gb|KPI91502.1| (Protein phosphatase Slingshot [Papilio xuthus])

HSP 1 Score: 149.443 bits (376), Expect = 2.985e-38
Identity = 98/155 (63.23%), Postives = 105/155 (67.74%), Query Frame = 0
Query:   30 GLVSNLKKEFEARSEAEAARRGKAPREAAG------DLSVRLLVDQY--------EPTGGARRSRPET-RAR-------VRNSFCGAVRGAGGERPPPAP--TVVSLAPLDYSDVVVSTVMSKAQNKKQLQHGKTHPLTRLNLNRSSNRCSNPVY 160
            GLVSNLKKEFEARSE E ARRG +            DLSVR+LV +Y        E  G A R  PE  +AR       VRNSFCG  R A    PP AP   V+SLAP+DYS+VVVSTVMSKAQNKKQLQHGKTHPLTRLNLNRSSNRCSNPVY
Sbjct:  846 GLVSNLKKEFEARSEGEGARRGGSRNRTGASPPLGEDLSVRVLVGRYDRPGRVRSESGGEAARRPPEAQKARAAEGGRGVRNSFCGGERPAPAMPPPAAPAPVVLSLAPVDYSNVVVSTVMSKAQNKKQLQHGKTHPLTRLNLNRSSNRCSNPVY 1000          
BLAST of HiSeq10016 vs. genbank:protein
Match: gi|913328626|ref|XP_013195834.1| (PREDICTED: protein phosphatase Slingshot [Amyelois transitella])

HSP 1 Score: 135.576 bits (340), Expect = 1.628e-33
Identity = 67/87 (77.01%), Postives = 75/87 (86.21%), Query Frame = 0
Query:   74 GGARRSRPETRARVRNSFCGAVRGAGGERPPPAPTVVSLAPLDYSDVVVSTVMSKAQNKKQLQHGKTHPLTRLNLNRSSNRCSNPVY 160
            GGA R+   + A +R+S+CGA      ERPPPAPTVVSLAP+DYSDVVVSTVMSKAQNKKQLQHGKTHPLTRLN+NRS+NRCSNPVY
Sbjct:  745 GGAARA---STAALRHSYCGA---RSAERPPPAPTVVSLAPIDYSDVVVSTVMSKAQNKKQLQHGKTHPLTRLNMNRSNNRCSNPVY 825          
BLAST of HiSeq10016 vs. genbank:protein
Match: gi|357603651|gb|EHJ63863.1| (putative slingshot dual specificity phosphatase [Danaus plexippus])

HSP 1 Score: 102.834 bits (255), Expect = 4.233e-22
Identity = 69/134 (51.49%), Postives = 81/134 (60.45%), Query Frame = 0
Query:   32 VSNLKKEFEARSEAEAARR-GKAPRE-AAGDLSVRLLVDQYEPTGGARR-----------------------SRPETRARVRNSFCGAVRGAGG-ERPPPAPTVVSLAPLDYSDVVVSTVMSKAQNKKQLQHGK 139
            VSNLKKEFEARSE+E  RR G   R+    DLSVR+LVD+Y+  G  R                        S  ++RAR+RNS+C  + G  G ERPP  PTVV+LAPLDYS+VVVSTVMSKAQNK     GK
Sbjct:  824 VSNLKKEFEARSESEVPRRSGSRTRQPQIEDLSVRVLVDRYDQPGRTRSESAAEPIRVKAPQESVSKKCKLASEVDSRARMRNSYCAGLAGGAGGERPPVVPTVVALAPLDYSNVVVSTVMSKAQNKNNYSMGK 957          
BLAST of HiSeq10016 vs. genbank:protein
Match: gi|910315966|ref|XP_013182269.1| (PREDICTED: LOW QUALITY PROTEIN: protein phosphatase Slingshot [Papilio xuthus])

HSP 1 Score: 92.0485 bits (227), Expect = 2.516e-18
Identity = 72/134 (53.73%), Postives = 79/134 (58.96%), Query Frame = 0
Query:   30 GLVSNLKKEFEARSEAEAARRGKAPREAAG------DLSVRLLVDQY--------EPTGGARRSRPET-RAR-------VRNSFCGAVRGAGGERPPPAP--TVVSLAPLDYSDVVVSTVMSKAQNKKQLQHGK 139
            GLVSNLKKEFEARSE E ARRG +            DLSVR+LV +Y        E  G A R  PE  +AR       VRNSFCG  R A    PP AP   V+SLAP+DYS+VVVSTVMSKAQNK     GK
Sbjct:  866 GLVSNLKKEFEARSEGEGARRGGSRNRTGASPPLGEDLSVRVLVGRYDRPGRVRSESGGEAARRPPEAQKARAADGGRGVRNSFCGGERPAPAMPPPAAPAPVVLSLAPVDYSNVVVSTVMSKAQNKNNCNMGK 999          
The following BLAST results are available for this feature:
BLAST of HiSeq10016 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 5
Match NameE-valueIdentityDescription
gi|827543663|ref|XP_012544718.1|2.101e-4757.23PREDICTED: protein phosphatase Slingshot [Bombyx m... [more]
gi|930649154|gb|KPI91502.1|2.985e-3863.23Protein phosphatase Slingshot [Papilio xuthus][more]
gi|913328626|ref|XP_013195834.1|1.628e-3377.01PREDICTED: protein phosphatase Slingshot [Amyelois... [more]
gi|357603651|gb|EHJ63863.1|4.233e-2251.49putative slingshot dual specificity phosphatase [D... [more]
gi|910315966|ref|XP_013182269.1|2.516e-1853.73PREDICTED: LOW QUALITY PROTEIN: protein phosphatas... [more]
back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0016787 hydrolase activity
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 1..159
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 160..183
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 184..187
NoneNo IPR availableTMHMMTMhelixcoord: 159..181

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq10016HiSeq10016Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq10016_p ID=HiSeq10016_p|Name=HiSeq10016|organism=Ostrinia scapulalis|type=polypeptide|length=187bp
RRRRPGEQPQEGVRGALGGRGGAARPPXAGLVSNLKKEFEARSEAEAARR
GKAPREAAGDLSVRLLVDQYEPTGGARRSRPETRARVRNSFCGAVRGAGG
ERPPPAPTVVSLAPLDYSDVVVSTVMSKAQNKKQLQHGKTHPLTRLNLNR
SSNRCSNPVYXYYVEVFMFFIYYEFLPNSIFYLSRVL
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0016787hydrolase activity