HiSeq10_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq10
Unique NameHiSeq10_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length252
Homology
BLAST of HiSeq10 vs. genbank:protein
Match: gi|357613671|gb|EHJ68643.1| (hypothetical protein KGM_17839 [Danaus plexippus])

HSP 1 Score: 504.597 bits (1298), Expect = 1.896e-174
Identity = 238/252 (94.44%), Postives = 244/252 (96.83%), Query Frame = 0
Query:    1 TSFSRNIVTPWKENISLSCNKVGVPTPSTTWSMNGATLESTLRKNVSNDGTLVISMTQYADSGNYTCSVENIHGRDEVTYSVEVKVPPQPPVLAVVDSYADSLHLQWSDQGDGGSPILGYVINYKREHGDWEELQVEAGTSEHVLPNLWCGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTTVTVWLDSWGDGGCGILYFVIEYREISQSQWRLVSNSVQATERVFSVPGLTPAAHY 252
            TSFSR+IVTPWKENISL+CNKVGVP PSTTW MNGA LESTLRKNV++DGTL+ISMTQYADSGNYTC VEN HGRDEVTY VEVKVPPQPPVLAVVDSYADSLHLQWSDQGDGGSPILGYVINYKREHGDWEELQVEAGTSEHVLPNLWCGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTTVTVWLDSWGDGGCGILYFVIEYREISQSQWRLVSNSVQATERVFSV GL+PA HY
Sbjct:   52 TSFSRSIVTPWKENISLACNKVGVPIPSTTWRMNGAILESTLRKNVTSDGTLIISMTQYADSGNYTCLVENTHGRDEVTYGVEVKVPPQPPVLAVVDSYADSLHLQWSDQGDGGSPILGYVINYKREHGDWEELQVEAGTSEHVLPNLWCGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTTVTVWLDSWGDGGCGILYFVIEYREISQSQWRLVSNSVQATERVFSVTGLSPATHY 303          
BLAST of HiSeq10 vs. genbank:protein
Match: gi|910320640|ref|XP_013163216.1| (PREDICTED: Down syndrome cell adhesion molecule-like protein Dscam2 [Papilio xuthus])

HSP 1 Score: 510.375 bits (1313), Expect = 2.057e-165
Identity = 241/252 (95.63%), Postives = 246/252 (97.62%), Query Frame = 0
Query:    1 TSFSRNIVTPWKENISLSCNKVGVPTPSTTWSMNGATLESTLRKNVSNDGTLVISMTQYADSGNYTCSVENIHGRDEVTYSVEVKVPPQPPVLAVVDSYADSLHLQWSDQGDGGSPILGYVINYKREHGDWEELQVEAGTSEHVLPNLWCGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTTVTVWLDSWGDGGCGILYFVIEYREISQSQWRLVSNSVQATERVFSVPGLTPAAHY 252
            TSFSR+IVTPWKENISLSCNKVGVPTPSTTWSMNGA LESTLRKNV+NDGTL+ISMTQYADSGNYTC+VEN HGRDEVTYSVEVKVPPQPPVLAVVDSYADSLHLQWSDQGDGGSPILGYVINYKREHGDWEELQVEAGTSEHVLPNLWCGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTTVTVWLDSWGDGGCGILYFVIEYREISQ+ WRLVSNSVQATERVFSV GL PA HY
Sbjct: 1226 TSFSRSIVTPWKENISLSCNKVGVPTPSTTWSMNGAVLESTLRKNVTNDGTLIISMTQYADSGNYTCTVENAHGRDEVTYSVEVKVPPQPPVLAVVDSYADSLHLQWSDQGDGGSPILGYVINYKREHGDWEELQVEAGTSEHVLPNLWCGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTTVTVWLDSWGDGGCGILYFVIEYREISQTPWRLVSNSVQATERVFSVTGLAPATHY 1477          

HSP 2 Score: 77.411 bits (189), Expect = 1.365e-12
Identity = 56/203 (27.59%), Postives = 96/203 (47.29%), Query Frame = 0
Query:   41 TLRKNVSNDG---TLVISMTQYADSGNYTCSVENIHGRDEVTYSVEVK-VPPQPPVLAVVDSYADSLHLQWSDQGDGGSPILGYVINYKREHGDW----EELQVEAGTSEHVLPNLWCGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTT--VTVWLDSWGDGGCG-ILYFVIEYREISQSQWRLVSN 232
            T+R+ V +DG    L I  T   D+G  TC   N +G+DE+   + V+ VP  P  + ++D  + S+ + W+    G SPI+ Y++ YK     W    +++ V    +   + NL   T Y L I A NR+G   P  +V   T   VP  P     +   ++T  +  W     D   G IL + + ++E++ +   L+++
Sbjct:  759 TIREQVLDDGLVSELSILQTYRQDTGALTCRASNAYGQDEMLIHLVVQEVPEMPKNIRIIDQQSRSIQISWTQPYAGNSPIINYIVQYKEAPEPWPTTPQKVIVPGSVTSASVQNLQPATSYHLRIIAENRLGQSEPSQLVQVTTTEEVPSGPPLDVRVEPKSSTELIVSWDPPQKDLWNGNILGYYVGFQELNNNSSVLIAS 961          
BLAST of HiSeq10 vs. genbank:protein
Match: gi|943967027|ref|XP_014365514.1| (PREDICTED: Down syndrome cell adhesion molecule-like protein Dscam2 [Papilio machaon])

HSP 1 Score: 509.605 bits (1311), Expect = 1.664e-164
Identity = 240/252 (95.24%), Postives = 246/252 (97.62%), Query Frame = 0
Query:    1 TSFSRNIVTPWKENISLSCNKVGVPTPSTTWSMNGATLESTLRKNVSNDGTLVISMTQYADSGNYTCSVENIHGRDEVTYSVEVKVPPQPPVLAVVDSYADSLHLQWSDQGDGGSPILGYVINYKREHGDWEELQVEAGTSEHVLPNLWCGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTTVTVWLDSWGDGGCGILYFVIEYREISQSQWRLVSNSVQATERVFSVPGLTPAAHY 252
            TSFSR+IVTPWKENISLSCNKVG+PTPSTTWSMNGA LESTLRKNV+NDGTL+ISMTQYADSGNYTC+VEN HGRDEVTYSVEVKVPPQPPVLAVVDSYADSLHLQWSDQGDGGSPILGYVINYKREHGDWEELQVEAGTSEHVLPNLWCGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTTVTVWLDSWGDGGCGILYFVIEYREISQ+ WRLVSNSVQATERVFSV GL PA HY
Sbjct: 1349 TSFSRSIVTPWKENISLSCNKVGIPTPSTTWSMNGAVLESTLRKNVTNDGTLIISMTQYADSGNYTCAVENAHGRDEVTYSVEVKVPPQPPVLAVVDSYADSLHLQWSDQGDGGSPILGYVINYKREHGDWEELQVEAGTSEHVLPNLWCGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTTVTVWLDSWGDGGCGILYFVIEYREISQTPWRLVSNSVQATERVFSVTGLAPATHY 1600          

HSP 2 Score: 77.411 bits (189), Expect = 1.642e-12
Identity = 56/203 (27.59%), Postives = 96/203 (47.29%), Query Frame = 0
Query:   41 TLRKNVSNDG---TLVISMTQYADSGNYTCSVENIHGRDEVTYSVEVK-VPPQPPVLAVVDSYADSLHLQWSDQGDGGSPILGYVINYKREHGDW----EELQVEAGTSEHVLPNLWCGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTT--VTVWLDSWGDGGCG-ILYFVIEYREISQSQWRLVSN 232
            T+R+ V +DG    L I  T   D+G  TC   N +G+DE+   + V+ VP  P  + ++D  + S+ + W+    G SPI+ Y++ YK     W    +++ V    +   + NL   T Y L I A NR+G   P  +V   T   VP  P     +   ++T  +  W     D   G IL + + ++E++ +   L+++
Sbjct:  882 TIREQVLDDGLVSELSILQTYRQDTGALTCRASNAYGQDEMLIHLVVQEVPEMPKNIRIIDQQSRSIQISWTQPYAGNSPIINYIVQYKEAPEPWPTTPQKVIVPGSVTSASVQNLQPATSYHLRIIAENRLGQSEPSQLVQVTTTEEVPSGPPLDVRVEPKSSTELIVSWDPPQKDLWNGNILGYYVGFQELNNNSSVLIAS 1084          
BLAST of HiSeq10 vs. genbank:protein
Match: gi|930668721|gb|KPJ09727.1| (Down syndrome cell adhesion molecule-like protein CG42256 [Papilio machaon])

HSP 1 Score: 509.605 bits (1311), Expect = 2.129e-164
Identity = 240/252 (95.24%), Postives = 246/252 (97.62%), Query Frame = 0
Query:    1 TSFSRNIVTPWKENISLSCNKVGVPTPSTTWSMNGATLESTLRKNVSNDGTLVISMTQYADSGNYTCSVENIHGRDEVTYSVEVKVPPQPPVLAVVDSYADSLHLQWSDQGDGGSPILGYVINYKREHGDWEELQVEAGTSEHVLPNLWCGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTTVTVWLDSWGDGGCGILYFVIEYREISQSQWRLVSNSVQATERVFSVPGLTPAAHY 252
            TSFSR+IVTPWKENISLSCNKVG+PTPSTTWSMNGA LESTLRKNV+NDGTL+ISMTQYADSGNYTC+VEN HGRDEVTYSVEVKVPPQPPVLAVVDSYADSLHLQWSDQGDGGSPILGYVINYKREHGDWEELQVEAGTSEHVLPNLWCGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTTVTVWLDSWGDGGCGILYFVIEYREISQ+ WRLVSNSVQATERVFSV GL PA HY
Sbjct: 1387 TSFSRSIVTPWKENISLSCNKVGIPTPSTTWSMNGAVLESTLRKNVTNDGTLIISMTQYADSGNYTCAVENAHGRDEVTYSVEVKVPPQPPVLAVVDSYADSLHLQWSDQGDGGSPILGYVINYKREHGDWEELQVEAGTSEHVLPNLWCGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTTVTVWLDSWGDGGCGILYFVIEYREISQTPWRLVSNSVQATERVFSVTGLAPATHY 1638          

HSP 2 Score: 77.411 bits (189), Expect = 1.442e-12
Identity = 56/203 (27.59%), Postives = 96/203 (47.29%), Query Frame = 0
Query:   41 TLRKNVSNDG---TLVISMTQYADSGNYTCSVENIHGRDEVTYSVEVK-VPPQPPVLAVVDSYADSLHLQWSDQGDGGSPILGYVINYKREHGDW----EELQVEAGTSEHVLPNLWCGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTT--VTVWLDSWGDGGCG-ILYFVIEYREISQSQWRLVSN 232
            T+R+ V +DG    L I  T   D+G  TC   N +G+DE+   + V+ VP  P  + ++D  + S+ + W+    G SPI+ Y++ YK     W    +++ V    +   + NL   T Y L I A NR+G   P  +V   T   VP  P     +   ++T  +  W     D   G IL + + ++E++ +   L+++
Sbjct:  920 TIREQVLDDGLVSELSILQTYRQDTGALTCRASNAYGQDEMLIHLVVQEVPEMPKNIRIIDQQSRSIQISWTQPYAGNSPIINYIVQYKEAPEPWPTTPQKVIVPGSVTSASVQNLQPATSYHLRIIAENRLGQSEPSQLVQVTTTEEVPSGPPLDVRVEPKSSTELIVSWDPPQKDLWNGNILGYYVGFQELNNNSSVLIAS 1122          
BLAST of HiSeq10 vs. genbank:protein
Match: gi|930664385|gb|KPJ05703.1| (Down syndrome cell adhesion molecule-like protein CG42256 [Papilio xuthus])

HSP 1 Score: 509.605 bits (1311), Expect = 3.064e-164
Identity = 241/252 (95.63%), Postives = 246/252 (97.62%), Query Frame = 0
Query:    1 TSFSRNIVTPWKENISLSCNKVGVPTPSTTWSMNGATLESTLRKNVSNDGTLVISMTQYADSGNYTCSVENIHGRDEVTYSVEVKVPPQPPVLAVVDSYADSLHLQWSDQGDGGSPILGYVINYKREHGDWEELQVEAGTSEHVLPNLWCGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTTVTVWLDSWGDGGCGILYFVIEYREISQSQWRLVSNSVQATERVFSVPGLTPAAHY 252
            TSFSR+IVTPWKENISLSCNKVGVPTPSTTWSMNGA LESTLRKNV+NDGTL+ISMTQYADSGNYTC+VEN HGRDEVTYSVEVKVPPQPPVLAVVDSYADSLHLQWSDQGDGGSPILGYVINYKREHGDWEELQVEAGTSEHVLPNLWCGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTTVTVWLDSWGDGGCGILYFVIEYREISQ+ WRLVSNSVQATERVFSV GL PA HY
Sbjct: 1436 TSFSRSIVTPWKENISLSCNKVGVPTPSTTWSMNGAVLESTLRKNVTNDGTLIISMTQYADSGNYTCTVENAHGRDEVTYSVEVKVPPQPPVLAVVDSYADSLHLQWSDQGDGGSPILGYVINYKREHGDWEELQVEAGTSEHVLPNLWCGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTTVTVWLDSWGDGGCGILYFVIEYREISQTPWRLVSNSVQATERVFSVTGLAPATHY 1687          

HSP 2 Score: 77.411 bits (189), Expect = 1.501e-12
Identity = 56/203 (27.59%), Postives = 96/203 (47.29%), Query Frame = 0
Query:   41 TLRKNVSNDG---TLVISMTQYADSGNYTCSVENIHGRDEVTYSVEVK-VPPQPPVLAVVDSYADSLHLQWSDQGDGGSPILGYVINYKREHGDW----EELQVEAGTSEHVLPNLWCGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTT--VTVWLDSWGDGGCG-ILYFVIEYREISQSQWRLVSN 232
            T+R+ V +DG    L I  T   D+G  TC   N +G+DE+   + V+ VP  P  + ++D  + S+ + W+    G SPI+ Y++ YK     W    +++ V    +   + NL   T Y L I A NR+G   P  +V   T   VP  P     +   ++T  +  W     D   G IL + + ++E++ +   L+++
Sbjct:  969 TIREQVLDDGLVSELSILQTYRQDTGALTCRASNAYGQDEMLIHLVVQEVPEMPKNIRIIDQQSRSIQISWTQPYAGNSPIINYIVQYKEAPEPWPTTPQKVIVPGSVTSASVQNLQPATSYHLRIIAENRLGQSEPSQLVQVTTTEEVPSGPPLDVRVEPKSSTELIVSWDPPQKDLWNGNILGYYVGFQELNNNSSVLIAS 1171          
BLAST of HiSeq10 vs. genbank:protein
Match: gi|768439081|ref|XP_011561153.1| (PREDICTED: Down syndrome cell adhesion molecule-like protein Dscam2 [Plutella xylostella])

HSP 1 Score: 503.827 bits (1296), Expect = 1.739e-163
Identity = 237/252 (94.05%), Postives = 245/252 (97.22%), Query Frame = 0
Query:    1 TSFSRNIVTPWKENISLSCNKVGVPTPSTTWSMNGATLESTLRKNVSNDGTLVISMTQYADSGNYTCSVENIHGRDEVTYSVEVKVPPQPPVLAVVDSYADSLHLQWSDQGDGGSPILGYVINYKREHGDWEELQVEAGTSEHVLPNLWCGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTTVTVWLDSWGDGGCGILYFVIEYREISQSQWRLVSNSVQATERVFSVPGLTPAAHY 252
            TSFSR+IVTPWKENISLSCNKVGVPTPST WSMNGA+LESTLRKNV++DGTL+ISMTQYADSGNYTC VEN+HGRDEVTY VEVKVPPQPPVLAVVDSYADSLHLQWSDQGDGGSPILGYVINYKREHGDWEELQVEAGTSEHVLPNLWCGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTTVTVWLDSWGDGGCGILYFVIEYRE+SQSQWRLVSNSVQATERVFSV  L+PA  Y
Sbjct: 1088 TSFSRSIVTPWKENISLSCNKVGVPTPSTMWSMNGASLESTLRKNVTSDGTLIISMTQYADSGNYTCVVENVHGRDEVTYGVEVKVPPQPPVLAVVDSYADSLHLQWSDQGDGGSPILGYVINYKREHGDWEELQVEAGTSEHVLPNLWCGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTTVTVWLDSWGDGGCGILYFVIEYREMSQSQWRLVSNSVQATERVFSVTSLSPATQY 1339          

HSP 2 Score: 75.485 bits (184), Expect = 6.643e-12
Identity = 46/153 (30.07%), Postives = 74/153 (48.37%), Query Frame = 0
Query:   41 TLRKNVSNDGT---LVISMTQYADSGNYTCSVENIHGRDEVTYSVEVK-VPPQPPVLAVVDSYADSLHLQWSDQGDGGSPILGYVINYKREHGDW----EELQVEAGTSEHVLPNLWCGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKP 185
            T+R+ V +DG    L I  T   D+G  TC   N +G+DE+   + V+ VP  P  + ++D  + ++ + W+    G SPI+ Y++ +K     W    +++ V    +   + NL   T Y L I A NR+G   P  +V   T   VP  P
Sbjct:  621 TIREQVLDDGIVSELSILQTYRQDTGALTCRAANAYGQDEMLIHLVVQEVPEMPKNIRIIDQQSRTIQISWTQPYAGNSPIINYIVQFKEASEPWPTTPQKVIVPGSVTSASVQNLQPATSYHLRIIAENRLGQSEPSQLVQVTTTEEVPSGP 773          
BLAST of HiSeq10 vs. genbank:protein
Match: gi|909563481|ref|XP_013136963.1| (PREDICTED: Down syndrome cell adhesion molecule-like protein Dscam2 [Papilio polytes])

HSP 1 Score: 506.138 bits (1302), Expect = 2.252e-163
Identity = 240/252 (95.24%), Postives = 245/252 (97.22%), Query Frame = 0
Query:    1 TSFSRNIVTPWKENISLSCNKVGVPTPSTTWSMNGATLESTLRKNVSNDGTLVISMTQYADSGNYTCSVENIHGRDEVTYSVEVKVPPQPPVLAVVDSYADSLHLQWSDQGDGGSPILGYVINYKREHGDWEELQVEAGTSEHVLPNLWCGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTTVTVWLDSWGDGGCGILYFVIEYREISQSQWRLVSNSVQATERVFSVPGLTPAAHY 252
            TSFSR+IVTPWKENISLSCNKVGVPTPSTTWSMNGA LESTLRKNVSNDGTL+ISMTQYADSGNYTC+VEN HGRD+VTYSVEVKVPPQPPVLAVVDSYADSLHLQWSDQGDGGSPILGYVINYKREHGDWEELQVEAGTSEHVLPNLWCGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTTVTVWLDSWGDGGCGILYFVIEYREISQ+ WRLVSNSVQATERVFSV GL  A HY
Sbjct: 1357 TSFSRSIVTPWKENISLSCNKVGVPTPSTTWSMNGAVLESTLRKNVSNDGTLIISMTQYADSGNYTCAVENAHGRDDVTYSVEVKVPPQPPVLAVVDSYADSLHLQWSDQGDGGSPILGYVINYKREHGDWEELQVEAGTSEHVLPNLWCGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTTVTVWLDSWGDGGCGILYFVIEYREISQTPWRLVSNSVQATERVFSVTGLAAATHY 1608          

HSP 2 Score: 77.411 bits (189), Expect = 1.551e-12
Identity = 56/203 (27.59%), Postives = 96/203 (47.29%), Query Frame = 0
Query:   41 TLRKNVSNDG---TLVISMTQYADSGNYTCSVENIHGRDEVTYSVEVK-VPPQPPVLAVVDSYADSLHLQWSDQGDGGSPILGYVINYKREHGDW----EELQVEAGTSEHVLPNLWCGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTT--VTVWLDSWGDGGCG-ILYFVIEYREISQSQWRLVSN 232
            T+R+ V +DG    L I  T   D+G  TC   N +G+DE+   + V+ VP  P  + ++D  + S+ + W+    G SPI+ Y++ YK     W    +++ V    +   + NL   T Y L I A NR+G   P  +V   T   VP  P     +   ++T  +  W     D   G IL + + ++E++ +   L+++
Sbjct:  890 TIREQVLDDGLVSELSILQTYRQDTGALTCRASNAYGQDEMLIHLVVQEVPEMPKNIRIIDQQSRSIQISWTQPYAGNSPIINYIVQYKEAPEPWPTTPQKVIVPGSVTSASVQNLQPATSYHLRIIAENRLGQSEPSQLVQVTTTEEVPSGPPLDVRVEPKSSTELIVSWDPPQKDLWNGNILGYYVGFQELNSNSSVLIAS 1092          
BLAST of HiSeq10 vs. genbank:protein
Match: gi|827562556|ref|XP_012551943.1| (PREDICTED: Down syndrome cell adhesion molecule-like protein Dscam2 [Bombyx mori])

HSP 1 Score: 505.368 bits (1300), Expect = 4.602e-163
Identity = 239/252 (94.84%), Postives = 245/252 (97.22%), Query Frame = 0
Query:    1 TSFSRNIVTPWKENISLSCNKVGVPTPSTTWSMNGATLESTLRKNVSNDGTLVISMTQYADSGNYTCSVENIHGRDEVTYSVEVKVPPQPPVLAVVDSYADSLHLQWSDQGDGGSPILGYVINYKREHGDWEELQVEAGTSEHVLPNLWCGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTTVTVWLDSWGDGGCGILYFVIEYREISQSQWRLVSNSVQATERVFSVPGLTPAAHY 252
            TSFSRNIVTPWKENISLSCNKVGVP P+TTW+MNG  LESTLRKNVS+DGTL ISMTQ ADSGNYTCSVENIHGRDEVTY+VEVKVPPQPP+LAVVDSYADSLHLQWSDQGDGGSPILGYVINYKREHGDWEELQVEAGTSEHVLPNLWCGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTTVTVWLDSWGDGGCGILYFVIEYRE+SQ QWRLVSNSVQATERVFSV GLTPAAHY
Sbjct: 1337 TSFSRNIVTPWKENISLSCNKVGVPAPATTWTMNGVGLESTLRKNVSSDGTLTISMTQSADSGNYTCSVENIHGRDEVTYTVEVKVPPQPPILAVVDSYADSLHLQWSDQGDGGSPILGYVINYKREHGDWEELQVEAGTSEHVLPNLWCGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTTVTVWLDSWGDGGCGILYFVIEYREMSQPQWRLVSNSVQATERVFSVSGLTPAAHY 1588          

HSP 2 Score: 77.7962 bits (190), Expect = 1.056e-12
Identity = 56/203 (27.59%), Postives = 95/203 (46.80%), Query Frame = 0
Query:   41 TLRKNVSNDG---TLVISMTQYADSGNYTCSVENIHGRDEVTYSVEVK-VPPQPPVLAVVDSYADSLHLQWSDQGDGGSPILGYVINYKREHGDW----EELQVEAGTSEHVLPNLWCGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTT--VTVWLDSWGDGGCG-ILYFVIEYREISQSQWRLVSN 232
            T+R+ V +DG    L I  T   D+G  TC   N +G+DE+   + V+ VP  P  + V+D  + ++ + W+    G SPI+ Y++ YK     W    +++ V    +   + NL   T Y L I A NR+G   P   V   T   VP  P     +   ++T  +  W     D   G IL + + ++E++ +   L+++
Sbjct:  870 TIREQVLDDGLVSELSILQTYRQDTGALTCRASNAYGQDEMLIHLVVQEVPEMPKNIRVIDQQSRTIQISWTQPYAGNSPIINYIVQYKEAPESWPSTPQKVIVPGSVTSASVQNLQPATSYHLRIIAENRLGQSEPSQPVQVTTTEEVPSGPPQDVRVEAKSSTELIVTWEPPQRDLWNGNILGYYVGFQELNSNSTVLIAS 1072          
BLAST of HiSeq10 vs. genbank:protein
Match: gi|913313329|ref|XP_013187436.1| (PREDICTED: Down syndrome cell adhesion molecule-like protein Dscam2 [Amyelois transitella])

HSP 1 Score: 504.597 bits (1298), Expect = 1.111e-162
Identity = 240/252 (95.24%), Postives = 245/252 (97.22%), Query Frame = 0
Query:    1 TSFSRNIVTPWKENISLSCNKVGVPTPSTTWSMNGATLESTLRKNVSNDGTLVISMTQYADSGNYTCSVENIHGRDEVTYSVEVKVPPQPPVLAVVDSYADSLHLQWSDQGDGGSPILGYVINYKREHGDWEELQVEAGTSEHVLPNLWCGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTTVTVWLDSWGDGGCGILYFVIEYREISQSQWRLVSNSVQATERVFSVPGLTPAAHY 252
            TSFSR+IVTPWKENISLSCNKVG PTP+TTWSMNGATLESTLRKNV++DGTL+ISMTQYADSGNYTCSVEN HG DEVTYSVEVKVPPQPPVLAVVDSYADSLHLQWSDQGDGGSPILGYVINYKREHGDWEELQVE GTSEHVLPNLWCGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTTVTVWLDSWGDGGCGILYFVIEYREISQSQWRLVSNSVQATERVFSV GLTPA  Y
Sbjct: 1362 TSFSRSIVTPWKENISLSCNKVGFPTPTTTWSMNGATLESTLRKNVTSDGTLIISMTQYADSGNYTCSVENAHGHDEVTYSVEVKVPPQPPVLAVVDSYADSLHLQWSDQGDGGSPILGYVINYKREHGDWEELQVELGTSEHVLPNLWCGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTTVTVWLDSWGDGGCGILYFVIEYREISQSQWRLVSNSVQATERVFSVTGLTPATQY 1613          

HSP 2 Score: 77.0258 bits (188), Expect = 1.947e-12
Identity = 55/194 (28.35%), Postives = 91/194 (46.91%), Query Frame = 0
Query:   41 TLRKNVSNDG---TLVISMTQYADSGNYTCSVENIHGRDEVTYSVEVK-VPPQPPVLAVVDSYADSLHLQWSDQGDGGSPILGYVINYKREHGDW----EELQVEAGTSEHVLPNLWCGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTT--VTVWLDSWGDGGCG-ILYFVIEYREIS 223
            T+R+ V +DG    L I  T   D+G  TC   N +G+DE+   + V+ VP  P  + ++D  + S+ + W+    G SPI+ Y++ YK     W    +++ V    +   + NL   T Y L I A NR+G   P  +V   T   VP  P     +   ++T  +  W     D   G IL + + ++E++
Sbjct:  895 TIREQVLDDGLVSELSILQTYRQDTGALTCRASNAYGQDEMLIHLVVQEVPEMPKNIRIIDQQSRSIQISWTQPYAGNSPIINYIVQYKEAPEPWPTTPQKVIVPGSVTSASVQNLQPATSYHLRIIAENRLGQSEPSQLVQVTTTEEVPSGPPLDVRVEAKSSTELIVSWEPPQRDLWNGNILGYYVGFQELN 1088          
BLAST of HiSeq10 vs. genbank:protein
Match: gi|914568152|gb|KOB72181.1| (Uncharacterized protein OBRU01_07784 [Operophtera brumata])

HSP 1 Score: 449.129 bits (1154), Expect = 7.883e-153
Identity = 214/226 (94.69%), Postives = 218/226 (96.46%), Query Frame = 0
Query:    1 TSFSRNIVTPWKENISLSCNKVGVPTPSTTWSMNGATLESTLRKNVSNDGTLVISMTQYADSGNYTCSVENIHGRDEVTYSVEVKVPPQPPVLAVVDSYADSLHLQWSDQGDGGSPILGYVINYKREHGDWEELQVEAGTSEHVLPNLWCGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTTVTVWLDSWGDGGCGILYFVIEYREISQSQ 226
            TSFSRNIVTPWKENISLSCNKVGVP+PSTTWSMNG   ESTLRKNV+ DGTL+ISMTQY DSGNYTC VENIHG D+VTYSVEVKVPPQPPVLAVVDSYADSLHLQWSDQGDGGSPILGYVINYKREHGDWEELQVEAGTSEHVLPNLWCGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTTVTVWLDSWGDGGCGILYFVIEYREIS SQ
Sbjct:   34 TSFSRNIVTPWKENISLSCNKVGVPSPSTTWSMNGVVFESTLRKNVTMDGTLIISMTQYTDSGNYTCLVENIHGHDDVTYSVEVKVPPQPPVLAVVDSYADSLHLQWSDQGDGGSPILGYVINYKREHGDWEELQVEAGTSEHVLPNLWCGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTTVTVWLDSWGDGGCGILYFVIEYREISHSQ 259          

HSP 2 Score: 68.5514 bits (166), Expect = 1.422e-9
Identity = 54/144 (37.50%), Postives = 65/144 (45.14%), Query Frame = 0
Query:   92 VLAVVDSYADSLHLQ----WSDQ-GDGGSPILGYVINYKREHGDWEELQVEAGTSEHVLPNLW----CGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTTVTVWLDSWGDGGCGILYFVIEYREISQSQ 226
            +L  V  Y +  H Q    W D  GDGG  IL +VI Y+         ++    +  V  + W    CG  Y  ++  +  I                      HSQ       TVTVWLDSWGDGGCGILYFVIEYREIS SQ
Sbjct:  245 ILYFVIEYREISHSQTVTVWLDSWGDGGCGILYFVIEYR---------EISHSQTVTVWLDSWGDGGCGILY--FVIEYREI---------------------SHSQ-------TVTVWLDSWGDGGCGILYFVIEYREISHSQ 349          

HSP 3 Score: 68.5514 bits (166), Expect = 1.422e-9
Identity = 54/144 (37.50%), Postives = 65/144 (45.14%), Query Frame = 0
Query:   92 VLAVVDSYADSLHLQ----WSDQ-GDGGSPILGYVINYKREHGDWEELQVEAGTSEHVLPNLW----CGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTTVTVWLDSWGDGGCGILYFVIEYREISQSQ 226
            +L  V  Y +  H Q    W D  GDGG  IL +VI Y+         ++    +  V  + W    CG  Y  ++  +  I                      HSQ       TVTVWLDSWGDGGCGILYFVIEYREIS SQ
Sbjct:  275 ILYFVIEYREISHSQTVTVWLDSWGDGGCGILYFVIEYR---------EISHSQTVTVWLDSWGDGGCGILY--FVIEYREI---------------------SHSQ-------TVTVWLDSWGDGGCGILYFVIEYREISHSQ 379          

HSP 4 Score: 68.5514 bits (166), Expect = 1.422e-9
Identity = 54/144 (37.50%), Postives = 65/144 (45.14%), Query Frame = 0
Query:   92 VLAVVDSYADSLHLQ----WSDQ-GDGGSPILGYVINYKREHGDWEELQVEAGTSEHVLPNLW----CGTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTTVTVWLDSWGDGGCGILYFVIEYREISQSQ 226
            +L  V  Y +  H Q    W D  GDGG  IL +VI Y+         ++    +  V  + W    CG  Y  ++  +  I                      HSQ       TVTVWLDSWGDGGCGILYFVIEYREIS SQ
Sbjct:  305 ILYFVIEYREISHSQTVTVWLDSWGDGGCGILYFVIEYR---------EISHSQTVTVWLDSWGDGGCGILY--FVIEYREI---------------------SHSQ-------TVTVWLDSWGDGGCGILYFVIEYREISHSQ 409          
The following BLAST results are available for this feature:
BLAST of HiSeq10 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|357613671|gb|EHJ68643.1|1.896e-17494.44hypothetical protein KGM_17839 [Danaus plexippus][more]
gi|910320640|ref|XP_013163216.1|2.057e-16595.63PREDICTED: Down syndrome cell adhesion molecule-li... [more]
gi|943967027|ref|XP_014365514.1|1.664e-16495.24PREDICTED: Down syndrome cell adhesion molecule-li... [more]
gi|930668721|gb|KPJ09727.1|2.129e-16495.24Down syndrome cell adhesion molecule-like protein ... [more]
gi|930664385|gb|KPJ05703.1|3.064e-16495.63Down syndrome cell adhesion molecule-like protein ... [more]
gi|768439081|ref|XP_011561153.1|1.739e-16394.05PREDICTED: Down syndrome cell adhesion molecule-li... [more]
gi|909563481|ref|XP_013136963.1|2.252e-16395.24PREDICTED: Down syndrome cell adhesion molecule-li... [more]
gi|827562556|ref|XP_012551943.1|4.602e-16394.84PREDICTED: Down syndrome cell adhesion molecule-li... [more]
gi|913313329|ref|XP_013187436.1|1.111e-16295.24PREDICTED: Down syndrome cell adhesion molecule-li... [more]
gi|914568152|gb|KOB72181.1|7.883e-15394.69Uncharacterized protein OBRU01_07784 [Operophtera ... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0016021 integral component of membrane
molecular_function GO:0005515 protein binding
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003598Immunoglobulin subtype 2SMARTSM00408IGc2coord: 10..74
e-value: 3.5E-7
score: 39.9
IPR003961Fibronectin type IIISMARTSM00060FN3coord: 87..167
e-value: 5.5E-9
score: 45.9
IPR003961Fibronectin type IIIPFAMPF00041fn3coord: 89..167
e-value: 3.1E-12
score: 46.3
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 181..252
score: 11.117
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 87..180
score: 20.899
IPR003961Fibronectin type IIISUPERFAMILY49265Fibronectin type IIIcoord: 86..252
IPR003599Immunoglobulin subtypeSMARTSM00409IGcoord: 4..85
e-value: 8.8E-4
score: 28.6
IPR013098Immunoglobulin I-setPFAMPF07679I-setcoord: 4..84
e-value: 1.2E-13
score: 50.5
IPR013783Immunoglobulin-like foldGENE3D2.60.40.10coord: 3..84
e-value: 3.4E-20
score: 71.8
IPR013783Immunoglobulin-like foldGENE3D2.60.40.10coord: 85..182
e-value: 6.8E-20
score: 70.7
IPR013783Immunoglobulin-like foldGENE3D2.60.40.10coord: 183..252
e-value: 9.9E-9
score: 34.9
NoneNo IPR availablePANTHERPTHR10489:SF580SUBFAMILY NOT NAMEDcoord: 2..252
NoneNo IPR availablePANTHERPTHR10489CELL ADHESION MOLECULEcoord: 2..252
NoneNo IPR availableSUPERFAMILY48726Immunoglobulincoord: 4..91
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 13..85
score: 11.606

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq10HiSeq10Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq10_p ID=HiSeq10_p|Name=HiSeq10|organism=Ostrinia scapulalis|type=polypeptide|length=252bp
TSFSRNIVTPWKENISLSCNKVGVPTPSTTWSMNGATLESTLRKNVSNDG
TLVISMTQYADSGNYTCSVENIHGRDEVTYSVEVKVPPQPPVLAVVDSYA
DSLHLQWSDQGDGGSPILGYVINYKREHGDWEELQVEAGTSEHVLPNLWC
GTRYQLYITAFNRIGTGLPCDIVHAYTKGTVPVKPKHSQMITLNTTTVTV
WLDSWGDGGCGILYFVIEYREISQSQWRLVSNSVQATERVFSVPGLTPAA
HY
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
Vocabulary: INTERPRO
TermDefinition
IPR007110Ig-like_dom
IPR013783Ig-like_fold
IPR013098Ig_I-set
IPR003599Ig_sub
IPR003961FN3_dom
IPR003598Ig_sub2