HiSeq20369_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq20369
Unique NameHiSeq20369_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length82
Homology
BLAST of HiSeq20369 vs. genbank:protein
Match: gi|727353038|gb|AIY55683.1| (putative arginine kinase, partial [Tuta absoluta])

HSP 1 Score: 175.252 bits (443), Expect = 1.233e-55
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 0
Query:    1 EMEDKVSSTLSGLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 82
            EMEDKVSSTLSGLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL
Sbjct:    6 EMEDKVSSTLSGLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 87          
BLAST of HiSeq20369 vs. genbank:protein
Match: gi|269116641|gb|ACZ26800.1| (arginine kinase, partial [Hypolimnas bolina])

HSP 1 Score: 178.333 bits (451), Expect = 2.537e-55
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 0
Query:    1 EMEDKVSSTLSGLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 82
            EMEDKVSSTLSGLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL
Sbjct:    1 EMEDKVSSTLSGLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 82          
BLAST of HiSeq20369 vs. genbank:protein
Match: gi|269116571|gb|ACZ26765.1| (arginine kinase, partial [Asterocampa idyja])

HSP 1 Score: 178.333 bits (451), Expect = 2.537e-55
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 0
Query:    1 EMEDKVSSTLSGLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 82
            EMEDKVSSTLSGLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL
Sbjct:    1 EMEDKVSSTLSGLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 82          
BLAST of HiSeq20369 vs. genbank:protein
Match: gi|161088216|gb|ABX57167.1| (arginine kinase, partial [Papilio glaucus])

HSP 1 Score: 178.333 bits (451), Expect = 2.537e-55
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 0
Query:    1 EMEDKVSSTLSGLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 82
            EMEDKVSSTLSGLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL
Sbjct:    1 EMEDKVSSTLSGLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 82          
BLAST of HiSeq20369 vs. genbank:protein
Match: gi|161088192|gb|ABX57155.1| (arginine kinase, partial [Marpesia eleuchea] >gi|269116607|gb|ACZ26783.1| arginine kinase, partial [Euryphura concordia] >gi|269116633|gb|ACZ26796.1| arginine kinase, partial [Hamanumida daedalus])

HSP 1 Score: 178.333 bits (451), Expect = 2.565e-55
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 0
Query:    1 EMEDKVSSTLSGLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 82
            EMEDKVSSTLSGLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL
Sbjct:    1 EMEDKVSSTLSGLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 82          
BLAST of HiSeq20369 vs. genbank:protein
Match: gi|161088178|gb|ABX57148.1| (arginine kinase, partial [Archiearis parthenias])

HSP 1 Score: 177.948 bits (450), Expect = 2.709e-55
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 0
Query:    1 EMEDKVSSTLSGLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 82
            EMEDKVSSTLSGLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL
Sbjct:    1 EMEDKVSSTLSGLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 82          
BLAST of HiSeq20369 vs. genbank:protein
Match: gi|269116589|gb|ACZ26774.1| (arginine kinase, partial [Castilia castilla])

HSP 1 Score: 177.948 bits (450), Expect = 2.925e-55
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 0
Query:    1 EMEDKVSSTLSGLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 82
            EMEDKVSSTLSGLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL
Sbjct:    1 EMEDKVSSTLSGLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 82          
BLAST of HiSeq20369 vs. genbank:protein
Match: gi|1049605671|dbj|BAV44317.1| (arginine kinase, partial [Caloptilia chrysolampra])

HSP 1 Score: 177.178 bits (448), Expect = 3.228e-55
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 0
Query:    1 EMEDKVSSTLSGLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 82
            EMEDKVSSTLSGLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL
Sbjct:   24 EMEDKVSSTLSGLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 105          
BLAST of HiSeq20369 vs. genbank:protein
Match: gi|299819086|gb|ADJ53643.1| (arginine kinase, partial [Bucculatrix sp. 1 ex Rhamnus costata])

HSP 1 Score: 177.563 bits (449), Expect = 3.337e-55
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 0
Query:    1 EMEDKVSSTLSGLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 82
            EMEDKVSSTLSGLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL
Sbjct:   29 EMEDKVSSTLSGLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 110          
BLAST of HiSeq20369 vs. genbank:protein
Match: gi|750678819|dbj|BAQ21701.1| (arginine kinase, partial [Epicephala sp. A AK-2014])

HSP 1 Score: 177.178 bits (448), Expect = 3.350e-55
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 0
Query:    1 EMEDKVSSTLSGLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 82
            EMEDKVSSTLSGLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL
Sbjct:   28 EMEDKVSSTLSGLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQAANACRFWPTGRGIYHNENKTFLVWCNEEDHL 109          
The following BLAST results are available for this feature:
BLAST of HiSeq20369 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|727353038|gb|AIY55683.1|1.233e-55100.00putative arginine kinase, partial [Tuta absoluta][more]
gi|269116641|gb|ACZ26800.1|2.537e-55100.00arginine kinase, partial [Hypolimnas bolina][more]
gi|269116571|gb|ACZ26765.1|2.537e-55100.00arginine kinase, partial [Asterocampa idyja][more]
gi|161088216|gb|ABX57167.1|2.537e-55100.00arginine kinase, partial [Papilio glaucus][more]
gi|161088192|gb|ABX57155.1|2.565e-55100.00arginine kinase, partial [Marpesia eleuchea] >gi|2... [more]
gi|161088178|gb|ABX57148.1|2.709e-55100.00arginine kinase, partial [Archiearis parthenias][more]
gi|269116589|gb|ACZ26774.1|2.925e-55100.00arginine kinase, partial [Castilia castilla][more]
gi|1049605671|dbj|BAV44317.1|3.228e-55100.00arginine kinase, partial [Caloptilia chrysolampra][more]
gi|299819086|gb|ADJ53643.1|3.337e-55100.00arginine kinase, partial [Bucculatrix sp. 1 ex Rha... [more]
gi|750678819|dbj|BAQ21701.1|3.350e-55100.00arginine kinase, partial [Epicephala sp. A AK-2014... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0016310 phosphorylation
molecular_function GO:0004054 arginine kinase activity
molecular_function GO:0003824 catalytic activity
molecular_function GO:0016301 kinase activity
molecular_function GO:0016772 transferase activity, transferring phosphorus-containing groups
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR022414ATP:guanido phosphotransferase, catalytic domainPFAMPF00217ATP-gua_Ptranscoord: 1..82
e-value: 1.5E-30
score: 106.1
IPR022414ATP:guanido phosphotransferase, catalytic domainPROSITEPS51510PHOSPHAGEN_KINASE_Ccoord: 1..82
score: 31.072
IPR014746Glutamine synthetase/guanido kinase, catalytic domainGENE3D3.30.590.10coord: 1..82
e-value: 8.8E-40
score: 135.9
IPR000749ATP:guanido phosphotransferasePANTHERPTHR11547ARGININE OR CREATINE KINASEcoord: 1..82
NoneNo IPR availableSUPERFAMILY55931Glutamine synthetase/guanido kinasecoord: 1..82

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq20369HiSeq20369Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq20369_p ID=HiSeq20369_p|Name=HiSeq20369|organism=Ostrinia scapulalis|type=polypeptide|length=82bp
EMEDKVSSTLSGLEGELKGTFYPLTGMSKETQQQLIDDHFLFKEGDRFLQ
AANACRFWPTGRGIYHNENKTFLVWCNEEDHL
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0016310phosphorylation
Vocabulary: Molecular Function
TermDefinition
GO:0004054arginine kinase activity
GO:0003824catalytic activity
GO:0016301kinase activity
GO:0016772transferase activity, transferring phosphorus-containing groups
Vocabulary: INTERPRO
TermDefinition
IPR000749ATP-guanido_PTrfase
IPR014746Gln_synth/guanido_kin_cat_dom
IPR022414ATP-guanido_PTrfase_cat