HiSeq36544_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq36544
Unique NameHiSeq36544_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length407
Homology
BLAST of HiSeq36544 vs. genbank:protein
Match: gi|827539104|ref|XP_012552740.1| (PREDICTED: protein FAM46C isoform X2 [Bombyx mori])

HSP 1 Score: 695.656 bits (1794), Expect = 0.000e+0
Identity = 360/407 (88.45%), Postives = 367/407 (90.17%), Query Frame = 0
Query:    1 MLDDMKSESSYTSSEEGCGGGERHAVLSYEQVRRLNDVMDEVVAIHGRGNFPTLHVRLRELVAGVRARLEAAPSAGGAGVAVRDVRLNGGAASHVLADRAQPYSDIDLIFTAELPTHRHCDRVKAAVLGHLATLMPPTTPRRRANPAGMKEAYVSKMVRVNSDGDRWSLISLGNSRGHKSVELKFVDTMRRQFEFSVDSFQIALDSLLAFHECAQLPIGENFYPTVVGESVYGDFGEALLHLSEKLIATRQPEEIRGGGLLKYCALLAKGYRPARPDKIKTLERYMCSRFFIDFPELGQQRAKLEAYLRNHFVGRDEETLKPRYLNLLHGVVRESTVCLMGHERRQTLALIEALACRELCARTLVLPGYVLACGVCAACPVCPACPACAAAAAAPCCDCYRPALCPA 407
            +LDDMKSESSYTSSEEGCG GERHAVLSYEQVRRLNDVMDEVVAIHGRGNFPTLHVRLRELVAGVRARLE A +AGGAGV+VRDVRLNGGAASHVL D  QPYSDIDLIFTAELPT RHCDRVKAAVLGHLATL+PP TPRRR  PAG+KEAYVSKMVRVNSDGDRWSLISLGNSRGHKSVELKFVD MRRQFEFSVDSFQIALDSLLAFHECAQLPIGENFYPTVVGESVYGDF EAL HLSEKLIATRQPEEIRGGGLLKYCALLAKGYR ARPDKIKTLERYMCSRFFIDFPELGQQRAKLEAYLRNHFVGR+EE LK RYL LLH VVRESTVCLMGHERRQTLALIEALACRELCART VL      C       VC  CPACA  A   CC+C RPALCPA
Sbjct:   19 LLDDMKSESSYTSSEEGCGAGERHAVLSYEQVRRLNDVMDEVVAIHGRGNFPTLHVRLRELVAGVRARLELAQAAGGAGVSVRDVRLNGGAASHVLGDNPQPYSDIDLIFTAELPTARHCDRVKAAVLGHLATLLPPATPRRRTTPAGLKEAYVSKMVRVNSDGDRWSLISLGNSRGHKSVELKFVDNMRRQFEFSVDSFQIALDSLLAFHECAQLPIGENFYPTVVGESVYGDFNEALHHLSEKLIATRQPEEIRGGGLLKYCALLAKGYRAARPDKIKTLERYMCSRFFIDFPELGQQRAKLEAYLRNHFVGREEEALKHRYLTLLHSVVRESTVCLMGHERRQTLALIEALACRELCARTPVLVQPYYLC-------VCTPCPACAYTA---CCECCRPALCPA 415          
BLAST of HiSeq36544 vs. genbank:protein
Match: gi|512892407|ref|XP_004922924.1| (PREDICTED: protein FAM46C isoform X1 [Bombyx mori] >gi|827539097|ref|XP_012552736.1| PREDICTED: protein FAM46C isoform X1 [Bombyx mori] >gi|827539099|ref|XP_012552737.1| PREDICTED: protein FAM46C isoform X1 [Bombyx mori] >gi|827539102|ref|XP_012552739.1| PREDICTED: protein FAM46C isoform X1 [Bombyx mori])

HSP 1 Score: 686.797 bits (1771), Expect = 0.000e+0
Identity = 345/391 (88.24%), Postives = 351/391 (89.77%), Query Frame = 0
Query:   17 GCGGGERHAVLSYEQVRRLNDVMDEVVAIHGRGNFPTLHVRLRELVAGVRARLEAAPSAGGAGVAVRDVRLNGGAASHVLADRAQPYSDIDLIFTAELPTHRHCDRVKAAVLGHLATLMPPTTPRRRANPAGMKEAYVSKMVRVNSDGDRWSLISLGNSRGHKSVELKFVDTMRRQFEFSVDSFQIALDSLLAFHECAQLPIGENFYPTVVGESVYGDFGEALLHLSEKLIATRQPEEIRGGGLLKYCALLAKGYRPARPDKIKTLERYMCSRFFIDFPELGQQRAKLEAYLRNHFVGRDEETLKPRYLNLLHGVVRESTVCLMGHERRQTLALIEALACRELCARTLVLPGYVLACGVCAACPVCPACPACAAAAAAPCCDCYRPALCPA 407
            GCG GERHAVLSYEQVRRLNDVMDEVVAIHGRGNFPTLHVRLRELVAGVRARLE A +AGGAGV+VRDVRLNGGAASHVL D  QPYSDIDLIFTAELPT RHCDRVKAAVLGHLATL+PP TPRRR  PAG+KEAYVSKMVRVNSDGDRWSLISLGNSRGHKSVELKFVD MRRQFEFSVDSFQIALDSLLAFHECAQLPIGENFYPTVVGESVYGDF EAL HLSEKLIATRQPEEIRGGGLLKYCALLAKGYR ARPDKIKTLERYMCSRFFIDFPELGQQRAKLEAYLRNHFVGR+EE LK RYL LLH VVRESTVCLMGHERRQTLALIEALACRELCART VL      C       VC  CPACA  A   CC+C RPALCPA
Sbjct:  131 GCGAGERHAVLSYEQVRRLNDVMDEVVAIHGRGNFPTLHVRLRELVAGVRARLELAQAAGGAGVSVRDVRLNGGAASHVLGDNPQPYSDIDLIFTAELPTARHCDRVKAAVLGHLATLLPPATPRRRTTPAGLKEAYVSKMVRVNSDGDRWSLISLGNSRGHKSVELKFVDNMRRQFEFSVDSFQIALDSLLAFHECAQLPIGENFYPTVVGESVYGDFNEALHHLSEKLIATRQPEEIRGGGLLKYCALLAKGYRAARPDKIKTLERYMCSRFFIDFPELGQQRAKLEAYLRNHFVGREEEALKHRYLTLLHSVVRESTVCLMGHERRQTLALIEALACRELCARTPVLVQPYYLC-------VCTPCPACAYTA---CCECCRPALCPA 511          
BLAST of HiSeq36544 vs. genbank:protein
Match: gi|1073528337|gb|JAT81280.1| (hypothetical protein g.7757, partial [Pectinophora gossypiella])

HSP 1 Score: 677.937 bits (1748), Expect = 0.000e+0
Identity = 333/366 (90.98%), Postives = 345/366 (94.26%), Query Frame = 0
Query:    1 MLDDMKSESSYTSSEEGCGGGERHAVLSYEQVRRLNDVMDEVVAIHGRGNFPTLHVRLRELVAGVRARLEAAPSAGGAGVAVRDVRLNGGAASHVLADRAQPYSDIDLIFTAELPTHRHCDRVKAAVLGHLATLMPPTTPRRRANPAGMKEAYVSKMVRVNSDGDRWSLISLGNSRGHKSVELKFVDTMRRQFEFSVDSFQIALDSLLAFHECAQLPIGENFYPTVVGESVYGDFGEALLHLSEKLIATRQPEEIRGGGLLKYCALLAKGYRPARPDKIKTLERYMCSRFFIDFPELGQQRAKLEAYLRNHFVGRDEETLKPRYLNLLHGVVRESTVCLMGHERRQTLALIEALACRELCARTLVL 366
            +LDDMKSESSY+ SE+GCG  ERHAVLSYEQVRRLNDVMDEVVAI+GRGNFPTLHVRLRELVAGVRARLE   SAGGAG+ VRDVRLNGGAASHVLADR QPYSDIDLIFTA+LPT RHCDR+K AVL HLATL+PP TPRRRA PAG+KEAYVSKMVRVNSDGDRWSLISLGNSRGHK+VELKFVDTMRRQFEFSVDSFQIALDSLLAFHECAQLPIGENFYPTVVGESVYGDF EALLHLSEKLIATRQPEEIRGGGLLKYCALLAK YRPARPDKIKTLERYMCSRFFIDFPELGQQRAKLEAYLRNHFVG +EE LK RYL LLHGVVRESTVCLMGHERRQTLALIEALACRELCAR  +L
Sbjct:   80 VLDDMKSESSYSPSEDGCG--ERHAVLSYEQVRRLNDVMDEVVAINGRGNFPTLHVRLRELVAGVRARLETCVSAGGAGINVRDVRLNGGAASHVLADRPQPYSDIDLIFTADLPTARHCDRIKTAVLSHLATLLPPATPRRRATPAGIKEAYVSKMVRVNSDGDRWSLISLGNSRGHKTVELKFVDTMRRQFEFSVDSFQIALDSLLAFHECAQLPIGENFYPTVVGESVYGDFHEALLHLSEKLIATRQPEEIRGGGLLKYCALLAKAYRPARPDKIKTLERYMCSRFFIDFPELGQQRAKLEAYLRNHFVGHEEEALKHRYLTLLHGVVRESTVCLMGHERRQTLALIEALACRELCARAPLL 443          
BLAST of HiSeq36544 vs. genbank:protein
Match: gi|357626059|gb|EHJ76285.1| (hypothetical protein KGM_10575 [Danaus plexippus])

HSP 1 Score: 667.152 bits (1720), Expect = 0.000e+0
Identity = 339/365 (92.88%), Postives = 346/365 (94.79%), Query Frame = 0
Query:    1 MLDDMKSESSYTSSEEGCGGGERHAVLSYEQVRRLNDVMDEVVAIHGRGNFPTLHVRLRELVAGVRARLEAAPSAGGAGVAVRDVRLNGGAASHVLADRAQPYSDIDLIFTAELPTHRHCDRVKAAVLGHLATLMPPTTPRRRAN---PAGMKEAYVSKMVRVNSDGDRWSLISLGNSRGHKSVELKFVDTMRRQFEFSVDSFQIALDSLLAFHECAQLPIGENFYPTVVGESVYGDFGEALLHLSEKLIATRQPEEIRGGGLLKYCALLAKGYRPARPDKIKTLERYMCSRFFIDFPELGQQRAKLEAYLRNHFVGRDEETLKPRYLNLLHGVVRESTVCLMGHERRQTLALIEALACRELCAR 362
            M DDMKSESSYTSSEEGCGGGERHAVLSYEQVRRLNDVMDEVV IHGRGNFPTLHVRLRELVAGVRARLE A S GGAG+ VRDVRLNGGAAS+VLADR QPYSDIDLIFTA+LPT RHCDRVKAAVL HL+TLMP  TPRRRA+   PAG+KEAYVSKMVRVNSDGDRWSLISLGNSRGHKSVELKFVDTMRRQFEFSVDSFQIALDSLLAFHECAQLPIGENFYPTVVGESVYGD+ EALLHLSEKLIATRQPEEIRGGGLLKYCALLAKGYRPARPDKIK LERYMCSRFFIDFPELGQQRAKLEAYLRNHFVGRDEE LK RYL LLHGVVRESTVCLMGHERRQTLALIEALACRELCAR
Sbjct:   19 MFDDMKSESSYTSSEEGCGGGERHAVLSYEQVRRLNDVMDEVVPIHGRGNFPTLHVRLRELVAGVRARLETAQSEGGAGITVRDVRLNGGAASNVLADRPQPYSDIDLIFTADLPTARHCDRVKAAVLSHLSTLMPAATPRRRASRASPAGLKEAYVSKMVRVNSDGDRWSLISLGNSRGHKSVELKFVDTMRRQFEFSVDSFQIALDSLLAFHECAQLPIGENFYPTVVGESVYGDYSEALLHLSEKLIATRQPEEIRGGGLLKYCALLAKGYRPARPDKIKILERYMCSRFFIDFPELGQQRAKLEAYLRNHFVGRDEEALKHRYLTLLHGVVRESTVCLMGHERRQTLALIEALACRELCAR 383          
BLAST of HiSeq36544 vs. genbank:protein
Match: gi|913308039|ref|XP_013184534.1| (PREDICTED: protein FAM46C isoform X2 [Amyelois transitella])

HSP 1 Score: 666.381 bits (1718), Expect = 0.000e+0
Identity = 354/419 (84.49%), Postives = 365/419 (87.11%), Query Frame = 0
Query:    1 MLDDMKSESSYTSSEEGCGGGERHAVLSYEQVRRLNDVMDEVVAIHGRGNFPTLHVRLRELVAGVRARLEAAPSAGGAGVAVRDVRLNGGAASHVLADRAQPYSDIDLIFTAELPTHRHCDRVKAAVLGHLATLMPPTTPRRRANPAGMKEAYVSKMVRVNSDGDRWSLISLGNSRGHKSVELKFVDTMRRQFEFSVDSFQIALDSLLAFHECAQLPIGENFYPTVVGESVYGDFGEALLHLSEKLIATRQPEEIRGGGLLKYCALLAKGYRPARPDKIKTLERYMCSRFFIDFPELGQQRAKLEAYLRNHFVGRDEETLKPRYLNLLHGVVRESTVCLMGHERRQTLALIEALACRELCA-RTLVL--PGYVLACGVCAACPVCPA---------CPACAAAAAAPCCDCYRPALCPA 407
            +LDDMKSESSYTSSEEGCGGGERHAVLSYEQVRRLNDVMDEVVAIHGRGNFPTLH+RLRELVAGVR RLE A SAGGAG+ VRDVRLNGGAASHVL D  QPYSDIDLIFTA+LPT RHCDRVKAAVLGHLATL+PP TPRRR +PAGMKEAYVSKMVRVNSDGDRWSLISLGNSRG KSVELKFVDTMRRQFEFSVDSFQIALDSLLAFHECAQLPIGENFYPTVVGESVYGDF EAL HL+EKLIATRQPEEIRGGGLLKYCALLAKGYRPARPDKIKTLERYMCSRFFIDFPELGQQRAKLEAYLRNHFVGR+EE LK RYL LLH VVRESTVCLMGHERRQTLALIEALA RE C  RTL+L  PGY +      A                P     A +PCCDC RP LCPA
Sbjct:   19 LLDDMKSESSYTSSEEGCGGGERHAVLSYEQVRRLNDVMDEVVAIHGRGNFPTLHIRLRELVAGVRTRLETAQSAGGAGITVRDVRLNGGAASHVLTDHPQPYSDIDLIFTADLPTARHCDRVKAAVLGHLATLLPPATPRRRVSPAGMKEAYVSKMVRVNSDGDRWSLISLGNSRGVKSVELKFVDTMRRQFEFSVDSFQIALDSLLAFHECAQLPIGENFYPTVVGESVYGDFHEALHHLAEKLIATRQPEEIRGGGLLKYCALLAKGYRPARPDKIKTLERYMCSRFFIDFPELGQQRAKLEAYLRNHFVGREEEALKHRYLLLLHSVVRESTVCLMGHERRQTLALIEALAHREFCVQRTLLLPPPGYYVCVCAACAACAACPACAVAAQHHPPLPVPPAPSPCCDCCRPTLCPA 437          
BLAST of HiSeq36544 vs. genbank:protein
Match: gi|913308037|ref|XP_013184533.1| (PREDICTED: protein FAM46C isoform X1 [Amyelois transitella])

HSP 1 Score: 658.677 bits (1698), Expect = 0.000e+0
Identity = 339/403 (84.12%), Postives = 349/403 (86.60%), Query Frame = 0
Query:   17 GCGGGERHAVLSYEQVRRLNDVMDEVVAIHGRGNFPTLHVRLRELVAGVRARLEAAPSAGGAGVAVRDVRLNGGAASHVLADRAQPYSDIDLIFTAELPTHRHCDRVKAAVLGHLATLMPPTTPRRRANPAGMKEAYVSKMVRVNSDGDRWSLISLGNSRGHKSVELKFVDTMRRQFEFSVDSFQIALDSLLAFHECAQLPIGENFYPTVVGESVYGDFGEALLHLSEKLIATRQPEEIRGGGLLKYCALLAKGYRPARPDKIKTLERYMCSRFFIDFPELGQQRAKLEAYLRNHFVGRDEETLKPRYLNLLHGVVRESTVCLMGHERRQTLALIEALACRELCA-RTLVL--PGYVLACGVCAACPVCPA---------CPACAAAAAAPCCDCYRPALCPA 407
            GCGGGERHAVLSYEQVRRLNDVMDEVVAIHGRGNFPTLH+RLRELVAGVR RLE A SAGGAG+ VRDVRLNGGAASHVL D  QPYSDIDLIFTA+LPT RHCDRVKAAVLGHLATL+PP TPRRR +PAGMKEAYVSKMVRVNSDGDRWSLISLGNSRG KSVELKFVDTMRRQFEFSVDSFQIALDSLLAFHECAQLPIGENFYPTVVGESVYGDF EAL HL+EKLIATRQPEEIRGGGLLKYCALLAKGYRPARPDKIKTLERYMCSRFFIDFPELGQQRAKLEAYLRNHFVGR+EE LK RYL LLH VVRESTVCLMGHERRQTLALIEALA RE C  RTL+L  PGY +      A                P     A +PCCDC RP LCPA
Sbjct:  131 GCGGGERHAVLSYEQVRRLNDVMDEVVAIHGRGNFPTLHIRLRELVAGVRTRLETAQSAGGAGITVRDVRLNGGAASHVLTDHPQPYSDIDLIFTADLPTARHCDRVKAAVLGHLATLLPPATPRRRVSPAGMKEAYVSKMVRVNSDGDRWSLISLGNSRGVKSVELKFVDTMRRQFEFSVDSFQIALDSLLAFHECAQLPIGENFYPTVVGESVYGDFHEALHHLAEKLIATRQPEEIRGGGLLKYCALLAKGYRPARPDKIKTLERYMCSRFFIDFPELGQQRAKLEAYLRNHFVGREEEALKHRYLLLLHSVVRESTVCLMGHERRQTLALIEALAHREFCVQRTLLLPPPGYYVCVCAACAACAACPACAVAAQHHPPLPVPPAPSPCCDCCRPTLCPA 533          
BLAST of HiSeq36544 vs. genbank:protein
Match: gi|914572780|gb|KOB75535.1| (Uncharacterized protein OBRU01_08275, partial [Operophtera brumata])

HSP 1 Score: 657.907 bits (1696), Expect = 0.000e+0
Identity = 324/349 (92.84%), Postives = 332/349 (95.13%), Query Frame = 0
Query:   18 CGGGERHAVLSYEQVRRLNDVMDEVVAIHGRGNFPTLHVRLRELVAGVRARLEAAPSAGGAGVAVRDVRLNGGAASHVLADRAQPYSDIDLIFTAELPTHRHCDRVKAAVLGHLATLMPPTTPRRRANPAGMKEAYVSKMVRVNSDGDRWSLISLGNSRGHKSVELKFVDTMRRQFEFSVDSFQIALDSLLAFHECAQLPIGENFYPTVVGESVYGDFGEALLHLSEKLIATRQPEEIRGGGLLKYCALLAKGYRPARPDKIKTLERYMCSRFFIDFPELGQQRAKLEAYLRNHFVGRDEETLKPRYLNLLHGVVRESTVCLMGHERRQTLALIEALACRELCARTLVL 366
            CGGGERHAVLSYEQVRRLNDVMDEVV IHGRGNFPTLHVRLRELVAGVRARLEAA + GGAGV VRDVRLNGGAAS VLADRAQPYSDIDLIFTA+LPT RHCDRVKAAVLGHLATLMPP TPR RA+PAG+KEAYVSKMVRVNSDGDRWSLISLGNSRGHK+VELKFVDTMRRQFEFSVDSFQIALDSLLAFHECA LPIGENFYPTVVGESV+GDFGEAL HL+EKLIATRQPEEIRGGGLLKYCALLAKGYR ARPDKIK LERYMCSRFFIDFPELGQQRAKLEAYLRNHFVGR+EE LK RYL LLHGVVRESTVCLMGHERRQTLALIEALACRELCAR  VL
Sbjct:   12 CGGGERHAVLSYEQVRRLNDVMDEVVPIHGRGNFPTLHVRLRELVAGVRARLEAAVADGGAGVTVRDVRLNGGAASSVLADRAQPYSDIDLIFTADLPTLRHCDRVKAAVLGHLATLMPPATPRHRASPAGLKEAYVSKMVRVNSDGDRWSLISLGNSRGHKTVELKFVDTMRRQFEFSVDSFQIALDSLLAFHECATLPIGENFYPTVVGESVFGDFGEALCHLAEKLIATRQPEEIRGGGLLKYCALLAKGYRAARPDKIKILERYMCSRFFIDFPELGQQRAKLEAYLRNHFVGREEEALKHRYLTLLHGVVRESTVCLMGHERRQTLALIEALACRELCARAPVL 360          
BLAST of HiSeq36544 vs. genbank:protein
Match: gi|943979080|ref|XP_014370442.1| (PREDICTED: protein FAM46C isoform X2 [Papilio machaon] >gi|930664821|gb|KPJ05952.1| Protein FAM46C [Papilio machaon])

HSP 1 Score: 633.254 bits (1632), Expect = 0.000e+0
Identity = 342/369 (92.68%), Postives = 349/369 (94.58%), Query Frame = 0
Query:    1 MLDDMKSESSYTSSEEGCGGGE---RHAVLSYEQVRRLNDVMDEVVAIHGRGNFPTLHVRLRELVAGVRARLEAAPSAGGAGVAVRDVRLNGGAASHVLADRAQPYSDIDLIFTAELPTHRHCDRVKAAVLGHLATLMPPTTPRRRANPAGMKEAYVSKMVRVNSDGDRWSLISLGNSRGHKSVELKFVDTMRRQFEFSVDSFQIALDSLLAFHECAQLPIGENFYPTVVGESVYGDFGEALLHLSEKLIATRQPEEIRGGGLLKYCALLAKGYRPARPDKIKTLERYMCSRFFIDFPELGQQRAKLEAYLRNHFVGRDEETLKPRYLNLLHGVVRESTVCLMGHERRQTLALIEALACRELCARTLVL 366
            MLDDMKSESSYTSSEEGCGG     RHAVLSYEQVRRLNDVMDEVV IHGRGNFPTLHVRLRELVAGVRARLEAA +AGGAGVAVRDVRLNGGAASHVLADRAQPYSDIDLIFTAELPT RHCDRVKAAVLGHLA LMPP TPRRRA PAG+KEAYVSKMVRVNSDGDRWSLISLGNSRGHKSVELKFVDTMRRQFEFSVDSFQIALDSLLAFHECAQLPIGENFYPTVVGESVYGDF EALLHL+EKLIATR+PEEIRGGGLLKYCALLAKGYR A PDKIKTLERYMCSRFFIDFPELGQQRAKLEAYLRNHFVGR+EE LK RYL LLHGVVRESTVCLMGHERRQTLALIE LACRELCAR  ++
Sbjct:   19 MLDDMKSESSYTSSEEGCGGAGGGERHAVLSYEQVRRLNDVMDEVVPIHGRGNFPTLHVRLRELVAGVRARLEAAVAAGGAGVAVRDVRLNGGAASHVLADRAQPYSDIDLIFTAELPTARHCDRVKAAVLGHLAALMPPATPRRRATPAGLKEAYVSKMVRVNSDGDRWSLISLGNSRGHKSVELKFVDTMRRQFEFSVDSFQIALDSLLAFHECAQLPIGENFYPTVVGESVYGDFDEALLHLTEKLIATRRPEEIRGGGLLKYCALLAKGYRAACPDKIKTLERYMCSRFFIDFPELGQQRAKLEAYLRNHFVGREEEALKHRYLTLLHGVVRESTVCLMGHERRQTLALIETLACRELCARAPIM 387          
BLAST of HiSeq36544 vs. genbank:protein
Match: gi|910312766|ref|XP_013171374.1| (PREDICTED: protein FAM46C isoform X2 [Papilio xuthus])

HSP 1 Score: 630.943 bits (1626), Expect = 0.000e+0
Identity = 341/369 (92.41%), Postives = 349/369 (94.58%), Query Frame = 0
Query:    1 MLDDMKSESSYTSSEEGCGGGE---RHAVLSYEQVRRLNDVMDEVVAIHGRGNFPTLHVRLRELVAGVRARLEAAPSAGGAGVAVRDVRLNGGAASHVLADRAQPYSDIDLIFTAELPTHRHCDRVKAAVLGHLATLMPPTTPRRRANPAGMKEAYVSKMVRVNSDGDRWSLISLGNSRGHKSVELKFVDTMRRQFEFSVDSFQIALDSLLAFHECAQLPIGENFYPTVVGESVYGDFGEALLHLSEKLIATRQPEEIRGGGLLKYCALLAKGYRPARPDKIKTLERYMCSRFFIDFPELGQQRAKLEAYLRNHFVGRDEETLKPRYLNLLHGVVRESTVCLMGHERRQTLALIEALACRELCARTLVL 366
            MLDDMKSESSYTSSEEGCGG     RHAVLSYEQVRRLNDVMDEVV IHGRGNFPTLHVRLRELVAGVRARLEAA +AGGAGVAVRDVRLNGGAASHVLADRAQPYSDIDLIFTAELPT RHCDRVKAAVLGHLA LMPP TPRRRA+PAG+KEAYVSKMVRVNSDGDRWSLISLGNSRGHKSVELKFVDTMRRQFEFSVDSFQIALDSLLAFHECAQLPIGENFYPTVVGESVYGDF EALLHL+EKLIATR+PEEIRGGGLLKYCALLAKGYR A PDKIKTLERYMCSRFFIDFPELGQQRAKLEAYLRNHFVG +EE LK RYL LLHGVVRESTVCLMGHERRQTLALIE LACRELCAR  ++
Sbjct:   19 MLDDMKSESSYTSSEEGCGGAGGGERHAVLSYEQVRRLNDVMDEVVPIHGRGNFPTLHVRLRELVAGVRARLEAAVAAGGAGVAVRDVRLNGGAASHVLADRAQPYSDIDLIFTAELPTARHCDRVKAAVLGHLAALMPPATPRRRASPAGLKEAYVSKMVRVNSDGDRWSLISLGNSRGHKSVELKFVDTMRRQFEFSVDSFQIALDSLLAFHECAQLPIGENFYPTVVGESVYGDFDEALLHLTEKLIATRRPEEIRGGGLLKYCALLAKGYRAACPDKIKTLERYMCSRFFIDFPELGQQRAKLEAYLRNHFVGHEEEALKHRYLTLLHGVVRESTVCLMGHERRQTLALIETLACRELCARAPIM 387          
BLAST of HiSeq36544 vs. genbank:protein
Match: gi|943979072|ref|XP_014370439.1| (PREDICTED: protein FAM46C isoform X1 [Papilio machaon] >gi|943979075|ref|XP_014370440.1| PREDICTED: protein FAM46C isoform X1 [Papilio machaon] >gi|943979078|ref|XP_014370441.1| PREDICTED: protein FAM46C isoform X1 [Papilio machaon])

HSP 1 Score: 629.787 bits (1623), Expect = 0.000e+0
Identity = 322/344 (93.60%), Postives = 329/344 (95.64%), Query Frame = 0
Query:   23 RHAVLSYEQVRRLNDVMDEVVAIHGRGNFPTLHVRLRELVAGVRARLEAAPSAGGAGVAVRDVRLNGGAASHVLADRAQPYSDIDLIFTAELPTHRHCDRVKAAVLGHLATLMPPTTPRRRANPAGMKEAYVSKMVRVNSDGDRWSLISLGNSRGHKSVELKFVDTMRRQFEFSVDSFQIALDSLLAFHECAQLPIGENFYPTVVGESVYGDFGEALLHLSEKLIATRQPEEIRGGGLLKYCALLAKGYRPARPDKIKTLERYMCSRFFIDFPELGQQRAKLEAYLRNHFVGRDEETLKPRYLNLLHGVVRESTVCLMGHERRQTLALIEALACRELCARTLVL 366
            RHAVLSYEQVRRLNDVMDEVV IHGRGNFPTLHVRLRELVAGVRARLEAA +AGGAGVAVRDVRLNGGAASHVLADRAQPYSDIDLIFTAELPT RHCDRVKAAVLGHLA LMPP TPRRRA PAG+KEAYVSKMVRVNSDGDRWSLISLGNSRGHKSVELKFVDTMRRQFEFSVDSFQIALDSLLAFHECAQLPIGENFYPTVVGESVYGDF EALLHL+EKLIATR+PEEIRGGGLLKYCALLAKGYR A PDKIKTLERYMCSRFFIDFPELGQQRAKLEAYLRNHFVGR+EE LK RYL LLHGVVRESTVCLMGHERRQTLALIE LACRELCAR  ++
Sbjct:  139 RHAVLSYEQVRRLNDVMDEVVPIHGRGNFPTLHVRLRELVAGVRARLEAAVAAGGAGVAVRDVRLNGGAASHVLADRAQPYSDIDLIFTAELPTARHCDRVKAAVLGHLAALMPPATPRRRATPAGLKEAYVSKMVRVNSDGDRWSLISLGNSRGHKSVELKFVDTMRRQFEFSVDSFQIALDSLLAFHECAQLPIGENFYPTVVGESVYGDFDEALLHLTEKLIATRRPEEIRGGGLLKYCALLAKGYRAACPDKIKTLERYMCSRFFIDFPELGQQRAKLEAYLRNHFVGREEEALKHRYLTLLHGVVRESTVCLMGHERRQTLALIETLACRELCARAPIM 482          
The following BLAST results are available for this feature:
BLAST of HiSeq36544 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|827539104|ref|XP_012552740.1|0.000e+088.45PREDICTED: protein FAM46C isoform X2 [Bombyx mori][more]
gi|512892407|ref|XP_004922924.1|0.000e+088.24PREDICTED: protein FAM46C isoform X1 [Bombyx mori]... [more]
gi|1073528337|gb|JAT81280.1|0.000e+090.98hypothetical protein g.7757, partial [Pectinophora... [more]
gi|357626059|gb|EHJ76285.1|0.000e+092.88hypothetical protein KGM_10575 [Danaus plexippus][more]
gi|913308039|ref|XP_013184534.1|0.000e+084.49PREDICTED: protein FAM46C isoform X2 [Amyelois tra... [more]
gi|913308037|ref|XP_013184533.1|0.000e+084.12PREDICTED: protein FAM46C isoform X1 [Amyelois tra... [more]
gi|914572780|gb|KOB75535.1|0.000e+092.84Uncharacterized protein OBRU01_08275, partial [Ope... [more]
gi|943979080|ref|XP_014370442.1|0.000e+092.68PREDICTED: protein FAM46C isoform X2 [Papilio mach... [more]
gi|910312766|ref|XP_013171374.1|0.000e+092.41PREDICTED: protein FAM46C isoform X2 [Papilio xuth... [more]
gi|943979072|ref|XP_014370439.1|0.000e+093.60PREDICTED: protein FAM46C isoform X1 [Papilio mach... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR012937Domain of unknown function DUF1693PFAMPF07984DUF1693coord: 27..354
e-value: 1.9E-142
score: 474.0
NoneNo IPR availablePANTHERPTHR12974PRION-LIKE-(Q/N-RICH)-DOMAIN-BEARING PROTEIN PROTEIN 44coord: 21..357

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq36544HiSeq36544Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq36544_p ID=HiSeq36544_p|Name=HiSeq36544|organism=Ostrinia scapulalis|type=polypeptide|length=407bp
MLDDMKSESSYTSSEEGCGGGERHAVLSYEQVRRLNDVMDEVVAIHGRGN
FPTLHVRLRELVAGVRARLEAAPSAGGAGVAVRDVRLNGGAASHVLADRA
QPYSDIDLIFTAELPTHRHCDRVKAAVLGHLATLMPPTTPRRRANPAGMK
EAYVSKMVRVNSDGDRWSLISLGNSRGHKSVELKFVDTMRRQFEFSVDSF
QIALDSLLAFHECAQLPIGENFYPTVVGESVYGDFGEALLHLSEKLIATR
QPEEIRGGGLLKYCALLAKGYRPARPDKIKTLERYMCSRFFIDFPELGQQ
RAKLEAYLRNHFVGRDEETLKPRYLNLLHGVVRESTVCLMGHERRQTLAL
IEALACRELCARTLVLPGYVLACGVCAACPVCPACPACAAAAAAPCCDCY
RPALCPA
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR012937DUF1693