HiSeq36545_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq36545
Unique NameHiSeq36545_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length417
Homology
BLAST of HiSeq36545 vs. genbank:protein
Match: gi|357613730|gb|EHJ68689.1| (putative spingomyelin synthetase [Danaus plexippus])

HSP 1 Score: 701.819 bits (1810), Expect = 0.000e+0
Identity = 336/379 (88.65%), Postives = 354/379 (93.40%), Query Frame = 0
Query:   41 CDVDIASHTAREDIKGINFE-RLKRNDLNNNASRQQQRPAEMPSQAELMQRQPLLARAAKKDAPPP--DESDPDQEHSPQRALAGDFVVEIPPGAVREERYPKEIWKTIVSFFFLFTCVCVNMMSLSLVHERLPDRNTTQPLNDIILDNIEAKDWGLAVSEYLIMISTTVAMLVVVFHKHRFIVARRLFLIIGLLYLYRSVTMFVTVMPVSSKTYYCSPKSNNTTPLLVIKRMFYLISGFGLSINGKHTYCGDYIYSGHTMVLVLSYLIVAEYSPRKLWPVHWAMWGSALLGVGFVLLAHGHYTVDVVIAYYVTTRLFWTFHSLLVTPHRAGSGYNVYMIQREWWYWLFAYLERNVRGPVPRRYDWPLPWPRTKLFSRL 416
            C VDIA+ T REDIKGINFE RLKRNDLNNNASR++    EMPSQAELMQRQPLLARA K DAP    DESDPDQ+HSPQR  AGDF+VEIP G VREERYPKEIWKTI+SFFFLF CVC+NMMSLSLVHERLPDRNTT PLNDIILDN+ A+DWGLAVSEYLIMISTTVAM+VVVFHKHRFIVARRLF IIGLLYLYRSVTMFVTV+PVSSKTY+CSPKSN+TTPLLVIKRMFYLISGFGLSINGKHTYCGDYIYSGHTMVLVLSYLIVAEYSP+KLWPVHWAMWGSA+LGV FVLLAHGHYTVDVVIAYY+TTRLFWTFHSLLVTPHR+G+GYN YMIQREWWYWLF YLERNVRGPVPRRYDWPLPWPRTKLFSRL
Sbjct:  102 CHVDIATSTDREDIKGINFEARLKRNDLNNNASRRRNDRREMPSQAELMQRQPLLARAVKADAPQATTDESDPDQDHSPQRTHAGDFMVEIPAGTVREERYPKEIWKTILSFFFLFLCVCINMMSLSLVHERLPDRNTTPPLNDIILDNVTAQDWGLAVSEYLIMISTTVAMIVVVFHKHRFIVARRLFFIIGLLYLYRSVTMFVTVLPVSSKTYFCSPKSNSTTPLLVIKRMFYLISGFGLSINGKHTYCGDYIYSGHTMVLVLSYLIVAEYSPKKLWPVHWAMWGSAVLGVSFVLLAHGHYTVDVVIAYYITTRLFWTFHSLLVTPHRSGNGYNHYMIQREWWYWLFTYLERNVRGPVPRRYDWPLPWPRTKLFSRL 480          
BLAST of HiSeq36545 vs. genbank:protein
Match: gi|943947607|ref|XP_014356912.1| (PREDICTED: phosphatidylcholine:ceramide cholinephosphotransferase 2-like [Papilio machaon] >gi|930676021|gb|KPJ16251.1| Phosphatidylcholine:ceramide cholinephosphotransferase 1 [Papilio machaon])

HSP 1 Score: 695.656 bits (1794), Expect = 0.000e+0
Identity = 338/390 (86.67%), Postives = 356/390 (91.28%), Query Frame = 0
Query:   32 APAAAPAPACDVDIASHTAREDIKGINFE-RLKRN--DLNNNASRQQQRPAEMPSQAELMQRQPLLARAAKKDAPPP--DESDPDQEHSPQRALAGDFVVEIPPGAVREERYPKEIWKTIVSFFFLFTCVCVNMMSLSLVHERLPDRNTTQPLNDIILDNIEAKDWGLAVSEYLIMISTTVAMLVVVFHKHRFIVARRLFLIIGLLYLYRSVTMFVTVMPVSSKTYYCSPKSNNTTPLLVIKRMFYLISGFGLSINGKHTYCGDYIYSGHTMVLVLSYLIVAEYSPRKLWPVHWAMWGSALLGVGFVLLAHGHYTVDVVIAYYVTTRLFWTFHSLLVTPHRAGSGYNVYMIQREWWYWLFAYLERNVRGPVPRRYDWPLPWPRTKLFSRL 416
            AP  AP P+C  DI S TAREDI+GINFE RL+RN  DLNNNASR+      MPSQAELMQRQPLLARA K DAP P  D+SDPDQ+HSPQR  A DFVVEIPPGAVREERYPKEIWKTI+SFFFLF CVC+NMMSLSLVHERLPDRNTT PL DIILDNI A+DWGLAVSEYLIMISTTVAM+VVVFHKHRFIVARR+F IIGLLYLYRSVTMFVTV+PVSS TYYCSPKSNNTTPLLVI+RMFYLISGFGLSINGKHTYCGDYIYSGHTMVLVLSYLIVAEYSP+KLWPVHWAMWGSA+LGV FVLLAHGHYTVDVVIAYYVTTRLFWTFHS+LVTP+R+G GYN YMIQREWWYWLF YLERNVRGPVPRRYDWPLPWPRTKLFSRL
Sbjct:   42 APTGAPPPSCHADIGSDTAREDIRGINFEPRLQRNGNDLNNNASRRA-----MPSQAELMQRQPLLARAVKPDAPQPATDDSDPDQDHSPQRIHATDFVVEIPPGAVREERYPKEIWKTIISFFFLFLCVCINMMSLSLVHERLPDRNTTAPLGDIILDNITARDWGLAVSEYLIMISTTVAMMVVVFHKHRFIVARRMFFIIGLLYLYRSVTMFVTVLPVSSTTYYCSPKSNNTTPLLVIRRMFYLISGFGLSINGKHTYCGDYIYSGHTMVLVLSYLIVAEYSPKKLWPVHWAMWGSAILGVSFVLLAHGHYTVDVVIAYYVTTRLFWTFHSMLVTPYRSGGGYNQYMIQREWWYWLFTYLERNVRGPVPRRYDWPLPWPRTKLFSRL 426          
BLAST of HiSeq36545 vs. genbank:protein
Match: gi|910342687|ref|XP_013175081.1| (PREDICTED: phosphatidylcholine:ceramide cholinephosphotransferase 2-like [Papilio xuthus])

HSP 1 Score: 688.723 bits (1776), Expect = 0.000e+0
Identity = 333/390 (85.38%), Postives = 353/390 (90.51%), Query Frame = 0
Query:   32 APAAAPAPACDVDIASHTAREDIKGINFE-RLKRN--DLNNNASRQQQRPAEMPSQAELMQRQPLLARAAKKDAPPP--DESDPDQEHSPQRALAGDFVVEIPPGAVREERYPKEIWKTIVSFFFLFTCVCVNMMSLSLVHERLPDRNTTQPLNDIILDNIEAKDWGLAVSEYLIMISTTVAMLVVVFHKHRFIVARRLFLIIGLLYLYRSVTMFVTVMPVSSKTYYCSPKSNNTTPLLVIKRMFYLISGFGLSINGKHTYCGDYIYSGHTMVLVLSYLIVAEYSPRKLWPVHWAMWGSALLGVGFVLLAHGHYTVDVVIAYYVTTRLFWTFHSLLVTPHRAGSGYNVYMIQREWWYWLFAYLERNVRGPVPRRYDWPLPWPRTKLFSRL 416
            AP   P  +C  DI S TAREDI+GINFE RL+RN  D+NNNASR+      MPSQAELMQRQPLLARA K DAP P  D+SDPDQ+HSPQR  A DFVVEIPPG VREERYPKEIWKTI+SFFFLF CVC+NMMSLSLVHERLPDRNTT PL DI+LDNI A+DWGLAVSEYLIMISTTVAM+VV+FHKHRFIVARR+F IIGLLYLYRSVTMFVTV+PVSS TYYCSPKSNNTTPLLVI+RMFYLISGFGLSINGKHTYCGDYIYSGHTMVLVLSYLIVAEYSP+KLWPVHWAMWGSA+LGV FVLLAHGHYTVDVVIAYYVTTRLFWTFHSLLVTP+R+G GYN YMIQREWWYWLF YLERNVRGPVPRRYDWPLPWPRTKLFSRL
Sbjct:   42 APTGTPPASCHADIGSDTAREDIRGINFEPRLQRNGNDVNNNASRRA-----MPSQAELMQRQPLLARAVKPDAPQPTTDDSDPDQDHSPQRTHATDFVVEIPPGTVREERYPKEIWKTIISFFFLFLCVCINMMSLSLVHERLPDRNTTSPLGDIVLDNITARDWGLAVSEYLIMISTTVAMMVVIFHKHRFIVARRMFFIIGLLYLYRSVTMFVTVLPVSSTTYYCSPKSNNTTPLLVIRRMFYLISGFGLSINGKHTYCGDYIYSGHTMVLVLSYLIVAEYSPKKLWPVHWAMWGSAILGVSFVLLAHGHYTVDVVIAYYVTTRLFWTFHSLLVTPYRSGGGYNQYMIQREWWYWLFTYLERNVRGPVPRRYDWPLPWPRTKLFSRL 426          
BLAST of HiSeq36545 vs. genbank:protein
Match: gi|909570206|ref|XP_013140639.1| (PREDICTED: phosphatidylcholine:ceramide cholinephosphotransferase 2-like isoform X1 [Papilio polytes])

HSP 1 Score: 688.723 bits (1776), Expect = 0.000e+0
Identity = 336/390 (86.15%), Postives = 356/390 (91.28%), Query Frame = 0
Query:   32 APAAAPAPACDVDIASHTAREDIKGINFE-RLKRN--DLNNNASRQQQRPAEMPSQAELMQRQPLLARAAKKDAPPP--DESDPDQEHSPQRALAGDFVVEIPPGAVREERYPKEIWKTIVSFFFLFTCVCVNMMSLSLVHERLPDRNTTQPLNDIILDNIEAKDWGLAVSEYLIMISTTVAMLVVVFHKHRFIVARRLFLIIGLLYLYRSVTMFVTVMPVSSKTYYCSPKSNNTTPLLVIKRMFYLISGFGLSINGKHTYCGDYIYSGHTMVLVLSYLIVAEYSPRKLWPVHWAMWGSALLGVGFVLLAHGHYTVDVVIAYYVTTRLFWTFHSLLVTPHRAGSGYNVYMIQREWWYWLFAYLERNVRGPVPRRYDWPLPWPRTKLFSRL 416
            AP  AP  AC  DI + TAR+DI+GINFE RL+RN  D+NNNASR+      MPSQAELMQRQPLLARAAK DAP P  D+SDPDQ+HSPQR  A DFVVEIPPGAVREERYPKEIWKTI+SFFFLF CVC+NMMSLSLVHERLPDRNTT PL DIILDNI A+DWGLAVSEYLIMISTTVAM+VVVFHKHRFIVARR+F IIGLLYLYRSVTMFVTV+PVSS TYYCSPKSNNTTPLLVI+RMFYLISGFGLSINGKHTYCGDYIYSGHTMVLVLSYLIVAEYSP+KLWPVHWAMWGSA+LGV FVLLAHGHYTVDVVIAYYVTTRLFWTFHS+LVTP+R+G GYN YMIQREWWYWLF YLERNVRGPVPRRYDWPLPWPRTKLFSRL
Sbjct:   87 APTGAPPTACHADIGNDTARDDIRGINFEPRLQRNGNDVNNNASRR-----AMPSQAELMQRQPLLARAAKPDAPQPTTDDSDPDQDHSPQRTHATDFVVEIPPGAVREERYPKEIWKTIISFFFLFMCVCINMMSLSLVHERLPDRNTTAPLGDIILDNITARDWGLAVSEYLIMISTTVAMMVVVFHKHRFIVARRMFFIIGLLYLYRSVTMFVTVLPVSSTTYYCSPKSNNTTPLLVIRRMFYLISGFGLSINGKHTYCGDYIYSGHTMVLVLSYLIVAEYSPKKLWPVHWAMWGSAILGVSFVLLAHGHYTVDVVIAYYVTTRLFWTFHSMLVTPYRSG-GYNQYMIQREWWYWLFTYLERNVRGPVPRRYDWPLPWPRTKLFSRL 470          
BLAST of HiSeq36545 vs. genbank:protein
Match: gi|909570208|ref|XP_013140640.1| (PREDICTED: phosphatidylcholine:ceramide cholinephosphotransferase 2-like isoform X2 [Papilio polytes])

HSP 1 Score: 688.337 bits (1775), Expect = 0.000e+0
Identity = 336/390 (86.15%), Postives = 356/390 (91.28%), Query Frame = 0
Query:   32 APAAAPAPACDVDIASHTAREDIKGINFE-RLKRN--DLNNNASRQQQRPAEMPSQAELMQRQPLLARAAKKDAPPP--DESDPDQEHSPQRALAGDFVVEIPPGAVREERYPKEIWKTIVSFFFLFTCVCVNMMSLSLVHERLPDRNTTQPLNDIILDNIEAKDWGLAVSEYLIMISTTVAMLVVVFHKHRFIVARRLFLIIGLLYLYRSVTMFVTVMPVSSKTYYCSPKSNNTTPLLVIKRMFYLISGFGLSINGKHTYCGDYIYSGHTMVLVLSYLIVAEYSPRKLWPVHWAMWGSALLGVGFVLLAHGHYTVDVVIAYYVTTRLFWTFHSLLVTPHRAGSGYNVYMIQREWWYWLFAYLERNVRGPVPRRYDWPLPWPRTKLFSRL 416
            AP  AP  AC  DI + TAR+DI+GINFE RL+RN  D+NNNASR+      MPSQAELMQRQPLLARAAK DAP P  D+SDPDQ+HSPQR  A DFVVEIPPGAVREERYPKEIWKTI+SFFFLF CVC+NMMSLSLVHERLPDRNTT PL DIILDNI A+DWGLAVSEYLIMISTTVAM+VVVFHKHRFIVARR+F IIGLLYLYRSVTMFVTV+PVSS TYYCSPKSNNTTPLLVI+RMFYLISGFGLSINGKHTYCGDYIYSGHTMVLVLSYLIVAEYSP+KLWPVHWAMWGSA+LGV FVLLAHGHYTVDVVIAYYVTTRLFWTFHS+LVTP+R+G GYN YMIQREWWYWLF YLERNVRGPVPRRYDWPLPWPRTKLFSRL
Sbjct:   42 APTGAPPTACHADIGNDTARDDIRGINFEPRLQRNGNDVNNNASRRA-----MPSQAELMQRQPLLARAAKPDAPQPTTDDSDPDQDHSPQRTHATDFVVEIPPGAVREERYPKEIWKTIISFFFLFMCVCINMMSLSLVHERLPDRNTTAPLGDIILDNITARDWGLAVSEYLIMISTTVAMMVVVFHKHRFIVARRMFFIIGLLYLYRSVTMFVTVLPVSSTTYYCSPKSNNTTPLLVIRRMFYLISGFGLSINGKHTYCGDYIYSGHTMVLVLSYLIVAEYSPKKLWPVHWAMWGSAILGVSFVLLAHGHYTVDVVIAYYVTTRLFWTFHSMLVTPYRSG-GYNQYMIQREWWYWLFTYLERNVRGPVPRRYDWPLPWPRTKLFSRL 425          
BLAST of HiSeq36545 vs. genbank:protein
Match: gi|930658891|gb|KPJ01073.1| (Phosphatidylcholine:ceramide cholinephosphotransferase 1, partial [Papilio xuthus])

HSP 1 Score: 686.411 bits (1770), Expect = 0.000e+0
Identity = 332/390 (85.13%), Postives = 352/390 (90.26%), Query Frame = 0
Query:   32 APAAAPAPACDVDIASHTAREDIKGINFE-RLKRN--DLNNNASRQQQRPAEMPSQAELMQRQPLLARAAKKDAPPP--DESDPDQEHSPQRALAGDFVVEIPPGAVREERYPKEIWKTIVSFFFLFTCVCVNMMSLSLVHERLPDRNTTQPLNDIILDNIEAKDWGLAVSEYLIMISTTVAMLVVVFHKHRFIVARRLFLIIGLLYLYRSVTMFVTVMPVSSKTYYCSPKSNNTTPLLVIKRMFYLISGFGLSINGKHTYCGDYIYSGHTMVLVLSYLIVAEYSPRKLWPVHWAMWGSALLGVGFVLLAHGHYTVDVVIAYYVTTRLFWTFHSLLVTPHRAGSGYNVYMIQREWWYWLFAYLERNVRGPVPRRYDWPLPWPRTKLFSRL 416
            AP   P  +C  DI S TAREDI+GINFE RL+RN  D+NNNASR+      MPSQAELMQRQPLLARA K DAP P  D+SDPDQ+HSPQR  A DFVVEIPPG VREERYPKEIWKTI+SFFFLF CVC+NMMSLSLVHERLPDRNTT PL DI+LDNI A+DWGLAVSEYLIMISTTVAM+VV+FHKHRFIVARR+F IIGLLYLYRSVTMFVTV+PVSS TYYCSPKSNNTTPLLVI+RMFYLISGFGLSINGKHTYCGDYIYSGHTMVLVLSYLIVAEYSP+KLWPVHWAMWGS +LGV FVLLAHGHYTVDVVIAYYVTTRLFWTFHSLLVTP+R+G GYN YMIQREWWYWLF YLERNVRGPVPRRYDWPLPWPRTKLFSRL
Sbjct:   49 APTGTPPASCHADIGSDTAREDIRGINFEPRLQRNGNDVNNNASRR-----AMPSQAELMQRQPLLARAVKPDAPQPTTDDSDPDQDHSPQRTHATDFVVEIPPGTVREERYPKEIWKTIISFFFLFLCVCINMMSLSLVHERLPDRNTTSPLGDIVLDNITARDWGLAVSEYLIMISTTVAMMVVIFHKHRFIVARRMFFIIGLLYLYRSVTMFVTVLPVSSTTYYCSPKSNNTTPLLVIRRMFYLISGFGLSINGKHTYCGDYIYSGHTMVLVLSYLIVAEYSPKKLWPVHWAMWGSPILGVSFVLLAHGHYTVDVVIAYYVTTRLFWTFHSLLVTPYRSGGGYNQYMIQREWWYWLFTYLERNVRGPVPRRYDWPLPWPRTKLFSRL 433          
BLAST of HiSeq36545 vs. genbank:protein
Match: gi|913312150|ref|XP_013186788.1| (PREDICTED: phosphatidylcholine:ceramide cholinephosphotransferase 2-like isoform X1 [Amyelois transitella])

HSP 1 Score: 686.026 bits (1769), Expect = 0.000e+0
Identity = 326/382 (85.34%), Postives = 349/382 (91.36%), Query Frame = 0
Query:   41 CDVDIASHTAREDIKGINFERLKRNDLNNNASRQQQ---RPA-EMPSQAELMQRQPLLARAAKKDAPPP--DESDPDQEHSPQRALAGDFVVEIPPGAVREERYPKEIWKTIVSFFFLFTCVCVNMMSLSLVHERLPDRNTTQPLNDIILDNIEAKDWGLAVSEYLIMISTTVAMLVVVFHKHRFIVARRLFLIIGLLYLYRSVTMFVTVMPVSSKTYYCSPKSNNTTPLLVIKRMFYLISGFGLSINGKHTYCGDYIYSGHTMVLVLSYLIVAEYSPRKLWPVHWAMWGSALLGVGFVLLAHGHYTVDVVIAYYVTTRLFWTFHSLLVTPHRAGSGYNVYMIQREWWYWLFAYLERNVRGPVPRRYDWPLPWPRTKLFSRL 416
            CDVDIASHT +++IKGINFERLKRNDLNNNASRQ     RP+ EMPSQAELMQRQPLLAR AKKDAP P  DESDPDQE SPQR   GDF+VEIP G VREERYPKEIWKTI+SFFFLF CVC+NMMSLSLVHERLPDRN T PLNDI+L+NI   DW L VSEYLIM+STTVAMLVVVFHKHRFIV+RRLF IIGLLYLYRS+TMFVTV+PVSSKTY+CSPK  N T L++IKRMFYLISGFGLSINGKHTYCGD+IYSGHTM+LVLSYL+VAEYSP+KLWP+HWAMWGSALLGV FVLLAHGHYTVDVVIAYY+TTRLFWTFHSLLVTPHRAG+GYN YMIQREWWYWLF YLERNVRGPVPRRYDWPLPWPRTKLFSRL
Sbjct:   98 CDVDIASHTVQDEIKGINFERLKRNDLNNNASRQNSEGARPSTEMPSQAELMQRQPLLARQAKKDAPQPATDESDPDQETSPQRT--GDFIVEIPAGTVREERYPKEIWKTIISFFFLFICVCINMMSLSLVHERLPDRNKTDPLNDIVLENIGPADWALDVSEYLIMVSTTVAMLVVVFHKHRFIVSRRLFFIIGLLYLYRSITMFVTVLPVSSKTYFCSPKEENVTSLVIIKRMFYLISGFGLSINGKHTYCGDFIYSGHTMILVLSYLVVAEYSPKKLWPMHWAMWGSALLGVSFVLLAHGHYTVDVVIAYYITTRLFWTFHSLLVTPHRAGNGYNHYMIQREWWYWLFTYLERNVRGPVPRRYDWPLPWPRTKLFSRL 477          
BLAST of HiSeq36545 vs. genbank:protein
Match: gi|913312152|ref|XP_013186789.1| (PREDICTED: phosphatidylcholine:ceramide cholinephosphotransferase 2-like isoform X2 [Amyelois transitella])

HSP 1 Score: 685.641 bits (1768), Expect = 0.000e+0
Identity = 326/383 (85.12%), Postives = 349/383 (91.12%), Query Frame = 0
Query:   40 ACDVDIASHTAREDIKGINFERLKRNDLNNNASRQQQ---RPA-EMPSQAELMQRQPLLARAAKKDAPPP--DESDPDQEHSPQRALAGDFVVEIPPGAVREERYPKEIWKTIVSFFFLFTCVCVNMMSLSLVHERLPDRNTTQPLNDIILDNIEAKDWGLAVSEYLIMISTTVAMLVVVFHKHRFIVARRLFLIIGLLYLYRSVTMFVTVMPVSSKTYYCSPKSNNTTPLLVIKRMFYLISGFGLSINGKHTYCGDYIYSGHTMVLVLSYLIVAEYSPRKLWPVHWAMWGSALLGVGFVLLAHGHYTVDVVIAYYVTTRLFWTFHSLLVTPHRAGSGYNVYMIQREWWYWLFAYLERNVRGPVPRRYDWPLPWPRTKLFSRL 416
             CDVDIASHT +++IKGINFERLKRNDLNNNASRQ     RP+ EMPSQAELMQRQPLLAR AKKDAP P  DESDPDQE SPQR   GDF+VEIP G VREERYPKEIWKTI+SFFFLF CVC+NMMSLSLVHERLPDRN T PLNDI+L+NI   DW L VSEYLIM+STTVAMLVVVFHKHRFIV+RRLF IIGLLYLYRS+TMFVTV+PVSSKTY+CSPK  N T L++IKRMFYLISGFGLSINGKHTYCGD+IYSGHTM+LVLSYL+VAEYSP+KLWP+HWAMWGSALLGV FVLLAHGHYTVDVVIAYY+TTRLFWTFHSLLVTPHRAG+GYN YMIQREWWYWLF YLERNVRGPVPRRYDWPLPWPRTKLFSRL
Sbjct:   57 VCDVDIASHTVQDEIKGINFERLKRNDLNNNASRQNSEGARPSTEMPSQAELMQRQPLLARQAKKDAPQPATDESDPDQETSPQRT--GDFIVEIPAGTVREERYPKEIWKTIISFFFLFICVCINMMSLSLVHERLPDRNKTDPLNDIVLENIGPADWALDVSEYLIMVSTTVAMLVVVFHKHRFIVSRRLFFIIGLLYLYRSITMFVTVLPVSSKTYFCSPKEENVTSLVIIKRMFYLISGFGLSINGKHTYCGDFIYSGHTMILVLSYLVVAEYSPKKLWPMHWAMWGSALLGVSFVLLAHGHYTVDVVIAYYITTRLFWTFHSLLVTPHRAGNGYNHYMIQREWWYWLFTYLERNVRGPVPRRYDWPLPWPRTKLFSRL 437          
BLAST of HiSeq36545 vs. genbank:protein
Match: gi|827550462|ref|XP_012547210.1| (PREDICTED: phosphatidylcholine:ceramide cholinephosphotransferase 2-like isoform X1 [Bombyx mori])

HSP 1 Score: 681.789 bits (1758), Expect = 0.000e+0
Identity = 323/382 (84.55%), Postives = 348/382 (91.10%), Query Frame = 0
Query:   41 CDVDIASHTAREDIKGINFE-RLKRNDLNNNASRQQQ---RPAEMPSQAELMQRQPLLARAAKKDAPPP--DESDPDQEHSPQRALAGDFVVEIPPGAVREERYPKEIWKTIVSFFFLFTCVCVNMMSLSLVHERLPDRNTTQPLNDIILDNIEAKDWGLAVSEYLIMISTTVAMLVVVFHKHRFIVARRLFLIIGLLYLYRSVTMFVTVMPVSSKTYYCSPKSNNTTPLLVIKRMFYLISGFGLSINGKHTYCGDYIYSGHTMVLVLSYLIVAEYSPRKLWPVHWAMWGSALLGVGFVLLAHGHYTVDVVIAYYVTTRLFWTFHSLLVTPHRAGSGYNVYMIQREWWYWLFAYLERNVRGPVPRRYDWPLPWPRTKLFSRL 416
            CDVDIAS TARE+IKGINFE R KRNDLNNN  RQQ    +   MPSQAELMQRQPLLAR  K DAP P  DESDPDQ+HSPQR   GDF++E+PPG VREERYPKEIWKTI+SFFFLF CVC+NM+SLSLVHERLPDRNTT+PLNDI+LDN+ A DWGLAVSEYLIM+STTVAMLVVVFHKHRFIVARRLF IIGLLYLYRS+TMFVTV+PVSS TY CSPKSN+T PLL+IKRMFYLISGFGLSINGKHTYCGDYIYSGHTMVLVLSYLIVAEYSP+KLWP+HWAM GSA++GV FVLLAHGHYTVDVVIAYY+TTRLFWTFHSLLVTPHR G+GYN YMIQREWWYW+F YLERNVRGPVPRRYDWPLPWPRTKLF+RL
Sbjct:  101 CDVDIASQTAREEIKGINFEARFKRNDLNNNPPRQQNDQPQNGTMPSQAELMQRQPLLARTTKTDAPQPATDESDPDQDHSPQRTHTGDFIIELPPGTVREERYPKEIWKTILSFFFLFMCVCINMISLSLVHERLPDRNTTKPLNDIVLDNVPAHDWGLAVSEYLIMVSTTVAMLVVVFHKHRFIVARRLFFIIGLLYLYRSITMFVTVLPVSSMTYTCSPKSNSTAPLLIIKRMFYLISGFGLSINGKHTYCGDYIYSGHTMVLVLSYLIVAEYSPKKLWPMHWAMAGSAVMGVSFVLLAHGHYTVDVVIAYYITTRLFWTFHSLLVTPHRTGNGYNHYMIQREWWYWVFTYLERNVRGPVPRRYDWPLPWPRTKLFNRL 482          
BLAST of HiSeq36545 vs. genbank:protein
Match: gi|512912756|ref|XP_004927734.1| (PREDICTED: phosphatidylcholine:ceramide cholinephosphotransferase 2-like isoform X2 [Bombyx mori])

HSP 1 Score: 681.404 bits (1757), Expect = 0.000e+0
Identity = 323/383 (84.33%), Postives = 348/383 (90.86%), Query Frame = 0
Query:   40 ACDVDIASHTAREDIKGINFE-RLKRNDLNNNASRQQQ---RPAEMPSQAELMQRQPLLARAAKKDAPPP--DESDPDQEHSPQRALAGDFVVEIPPGAVREERYPKEIWKTIVSFFFLFTCVCVNMMSLSLVHERLPDRNTTQPLNDIILDNIEAKDWGLAVSEYLIMISTTVAMLVVVFHKHRFIVARRLFLIIGLLYLYRSVTMFVTVMPVSSKTYYCSPKSNNTTPLLVIKRMFYLISGFGLSINGKHTYCGDYIYSGHTMVLVLSYLIVAEYSPRKLWPVHWAMWGSALLGVGFVLLAHGHYTVDVVIAYYVTTRLFWTFHSLLVTPHRAGSGYNVYMIQREWWYWLFAYLERNVRGPVPRRYDWPLPWPRTKLFSRL 416
             CDVDIAS TARE+IKGINFE R KRNDLNNN  RQQ    +   MPSQAELMQRQPLLAR  K DAP P  DESDPDQ+HSPQR   GDF++E+PPG VREERYPKEIWKTI+SFFFLF CVC+NM+SLSLVHERLPDRNTT+PLNDI+LDN+ A DWGLAVSEYLIM+STTVAMLVVVFHKHRFIVARRLF IIGLLYLYRS+TMFVTV+PVSS TY CSPKSN+T PLL+IKRMFYLISGFGLSINGKHTYCGDYIYSGHTMVLVLSYLIVAEYSP+KLWP+HWAM GSA++GV FVLLAHGHYTVDVVIAYY+TTRLFWTFHSLLVTPHR G+GYN YMIQREWWYW+F YLERNVRGPVPRRYDWPLPWPRTKLF+RL
Sbjct:   60 VCDVDIASQTAREEIKGINFEARFKRNDLNNNPPRQQNDQPQNGTMPSQAELMQRQPLLARTTKTDAPQPATDESDPDQDHSPQRTHTGDFIIELPPGTVREERYPKEIWKTILSFFFLFMCVCINMISLSLVHERLPDRNTTKPLNDIVLDNVPAHDWGLAVSEYLIMVSTTVAMLVVVFHKHRFIVARRLFFIIGLLYLYRSITMFVTVLPVSSMTYTCSPKSNSTAPLLIIKRMFYLISGFGLSINGKHTYCGDYIYSGHTMVLVLSYLIVAEYSPKKLWPMHWAMAGSAVMGVSFVLLAHGHYTVDVVIAYYITTRLFWTFHSLLVTPHRTGNGYNHYMIQREWWYWVFTYLERNVRGPVPRRYDWPLPWPRTKLFNRL 442          
The following BLAST results are available for this feature:
BLAST of HiSeq36545 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|357613730|gb|EHJ68689.1|0.000e+088.65putative spingomyelin synthetase [Danaus plexippus... [more]
gi|943947607|ref|XP_014356912.1|0.000e+086.67PREDICTED: phosphatidylcholine:ceramide cholinepho... [more]
gi|910342687|ref|XP_013175081.1|0.000e+085.38PREDICTED: phosphatidylcholine:ceramide cholinepho... [more]
gi|909570206|ref|XP_013140639.1|0.000e+086.15PREDICTED: phosphatidylcholine:ceramide cholinepho... [more]
gi|909570208|ref|XP_013140640.1|0.000e+086.15PREDICTED: phosphatidylcholine:ceramide cholinepho... [more]
gi|930658891|gb|KPJ01073.1|0.000e+085.13Phosphatidylcholine:ceramide cholinephosphotransfe... [more]
gi|913312150|ref|XP_013186788.1|0.000e+085.34PREDICTED: phosphatidylcholine:ceramide cholinepho... [more]
gi|913312152|ref|XP_013186789.1|0.000e+085.12PREDICTED: phosphatidylcholine:ceramide cholinepho... [more]
gi|827550462|ref|XP_012547210.1|0.000e+084.55PREDICTED: phosphatidylcholine:ceramide cholinepho... [more]
gi|512912756|ref|XP_004927734.1|0.000e+084.33PREDICTED: phosphatidylcholine:ceramide cholinepho... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0016021 integral component of membrane
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 57..78
NoneNo IPR availablePANTHERPTHR21290:SF27PHOSPHATIDYLCHOLINE:CERAMIDE CHOLINEPHOSPHOTRANSFERASE 1coord: 134..409
NoneNo IPR availablePANTHERPTHR21290SPHINGOMYELIN SYNTHETASEcoord: 134..409
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 192..213
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 346..363
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 309..319
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 320..340
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 364..417
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 248..290
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 1..145
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 291..308
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 225..247
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 341..345
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 167..191
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 214..224
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 146..166
NoneNo IPR availableTMHMMTMhelixcoord: 262..284
NoneNo IPR availableTMHMMTMhelixcoord: 192..214
NoneNo IPR availableTMHMMTMhelixcoord: 291..308
NoneNo IPR availableTMHMMTMhelixcoord: 225..247
NoneNo IPR availableTMHMMTMhelixcoord: 147..166
NoneNo IPR availableTMHMMTMhelixcoord: 318..340
IPR025749Sphingomyelin synthase-like domainPFAMPF14360PAP2_Ccoord: 288..360
e-value: 1.1E-25
score: 89.5

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq36545HiSeq36545Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq36545_p ID=HiSeq36545_p|Name=HiSeq36545|organism=Ostrinia scapulalis|type=polypeptide|length=417bp
MXXADISHWGDIKVAPHWKSPSLYSAACHGHAPAAAPAPACDVDIASHTA
REDIKGINFERLKRNDLNNNASRQQQRPAEMPSQAELMQRQPLLARAAKK
DAPPPDESDPDQEHSPQRALAGDFVVEIPPGAVREERYPKEIWKTIVSFF
FLFTCVCVNMMSLSLVHERLPDRNTTQPLNDIILDNIEAKDWGLAVSEYL
IMISTTVAMLVVVFHKHRFIVARRLFLIIGLLYLYRSVTMFVTVMPVSSK
TYYCSPKSNNTTPLLVIKRMFYLISGFGLSINGKHTYCGDYIYSGHTMVL
VLSYLIVAEYSPRKLWPVHWAMWGSALLGVGFVLLAHGHYTVDVVIAYYV
TTRLFWTFHSLLVTPHRAGSGYNVYMIQREWWYWLFAYLERNVRGPVPRR
YDWPLPWPRTKLFSRLX
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: INTERPRO
TermDefinition
IPR025749Sphingomyelin_synth-like_dom