HiSeq36547_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq36547
Unique NameHiSeq36547_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length702
Homology
BLAST of HiSeq36547 vs. genbank:protein
Match: gi|930680160|gb|KPJ19898.1| (Exportin-7 [Papilio machaon])

HSP 1 Score: 1282.32 bits (3317), Expect = 0.000e+0
Identity = 611/703 (86.91%), Postives = 655/703 (93.17%), Query Frame = 0
Query:    1 MVASVPYVKATEPHLLETYAPGVTAAYIESRLNSVPCVVRDGLEDPLDEAGTVQQQLEQLSVVARCEYAKSCRLLVAHFDRAAAAYSVQQNPQEILVLQGQLTWLVYIIGAAIGGRASVNTCDENDAMDGELVCRVLQLMDLTDSRLASGGCEKLELAMMSFFEHFRKIYVGEQVQKNSKVYRCLSEVLGLNDESQLLSVIMRKIITNLKYWGGSEQIIAKTLGLLSDLSGGYSCVRKLVKLDETQLMLTHHTAEHFPFLGIAGVGTAEMRCRTMLYTALGRLLMVELGEDEDTFHTFMMPITAAMESIIGLLGPPESPLFASEDAKKTLIGLARDLRGLAFAFNTKTTYMMLFDWIYPVYIKVLIRGIEVWFAEPALTTPVLKLTAELAQNRNQRLQLDVSSPNGILLFRELSNIICAYGSRILTVDVSKKQMYAMKLKGISLCFSILKAALCGNYANFGVFRLYGDEALDNALNMFVKLLLSIPQSDLHDYPKLSQTYYVLLERLAQDLMPFLASLQPEATLYILASISEGLTALDTSVCTGCCATLDHIVTYLFKQLVQKSSNKPPNPRQPPPEASNM-LQVLQRRPEIMQQLLATVLNVIMFEDCCNQWSMSRPLLGLILLNEEHFARLRGDMLAQQPRDKQPQLAHCFSALMAGVEPNLLTKNRDRFTQNLSIFRRDINDLLKGTLVNTSNVNDMMTS 702
            MVASVPYVKATEPH LETYAPGVTAAYI SRL+SV  VV +GLEDPLD+ GTVQQQLEQLSV+ RCEY K+C+LLVAHFDRAAA YSV+Q PQ+ILVLQGQLTWLVYIIGAAIGGRASV TCDENDAMDGELVCRVLQLMDLTDSRLA GGCEKLELAMMSFFE FRKIYVGEQVQK+SKVYR LSEVLGL DESQLLSV+MRKIITNLKYWGGSEQII+KTLGLLSDLSGGY+CVRKLV L+E Q MLTHHTAEHFPFLGI+GVG +EMRCRTMLYTALGRLLMVELGEDE+ FH FMMP+TAA ESIIGLLGPPESPLFASEDAKKTLIGLARDLRGLAFAFNTKTTYMMLFDWIYPVY+KVL+RG+E WF++P L+TPVLKL AELAQNRNQRL  DVSSPNGILLFRELS  ICAYGSRI+T++V+KK MYAMKLKGIS+CF ILKAALCGNYANFGVFRLYGDEALDNALNMFVKLLL IPQSDL DYPKLSQTYYVLLERLAQD MPFL+SLQPEATLYIL+SISEGLTALDTSVCTGCCATLDHIVTYLFKQLVQK+SNK PNPRQPPPE SNM ++VLQRRPEIMQQLLATVLNVIMFE+CCNQWSMSRPLLGL+LLNEE F+RLR +++++QPRDKQ QLAH FS LMAG+EPNLLTKNRDRFTQNLS FRRDINDLLKG  V++   NDMMTS
Sbjct:  346 MVASVPYVKATEPHQLETYAPGVTAAYIASRLDSVAVVVSEGLEDPLDDVGTVQQQLEQLSVIGRCEYGKTCQLLVAHFDRAAAEYSVEQRPQQILVLQGQLTWLVYIIGAAIGGRASVTTCDENDAMDGELVCRVLQLMDLTDSRLARGGCEKLELAMMSFFEQFRKIYVGEQVQKSSKVYRRLSEVLGLADESQLLSVLMRKIITNLKYWGGSEQIISKTLGLLSDLSGGYACVRKLVTLEEVQFMLTHHTAEHFPFLGISGVGPSEMRCRTMLYTALGRLLMVELGEDEERFHAFMMPLTAAFESIIGLLGPPESPLFASEDAKKTLIGLARDLRGLAFAFNTKTTYMMLFDWIYPVYLKVLLRGLEAWFSQPELSTPVLKLAAELAQNRNQRLHFDVSSPNGILLFRELSAFICAYGSRIVTIEVNKKDMYAMKLKGISVCFCILKAALCGNYANFGVFRLYGDEALDNALNMFVKLLLHIPQSDLLDYPKLSQTYYVLLERLAQDHMPFLSSLQPEATLYILSSISEGLTALDTSVCTGCCATLDHIVTYLFKQLVQKTSNKVPNPRQPPPETSNMFVEVLQRRPEIMQQLLATVLNVIMFEECCNQWSMSRPLLGLVLLNEEQFSRLRAELISRQPRDKQAQLAHWFSNLMAGIEPNLLTKNRDRFTQNLSTFRRDINDLLKGANVSSQQSNDMMTS 1048          
BLAST of HiSeq36547 vs. genbank:protein
Match: gi|943935236|ref|XP_014361096.1| (PREDICTED: exportin-7 [Papilio machaon])

HSP 1 Score: 1280.77 bits (3313), Expect = 0.000e+0
Identity = 611/703 (86.91%), Postives = 655/703 (93.17%), Query Frame = 0
Query:    1 MVASVPYVKATEPHLLETYAPGVTAAYIESRLNSVPCVVRDGLEDPLDEAGTVQQQLEQLSVVARCEYAKSCRLLVAHFDRAAAAYSVQQNPQEILVLQGQLTWLVYIIGAAIGGRASVNTCDENDAMDGELVCRVLQLMDLTDSRLASGGCEKLELAMMSFFEHFRKIYVGEQVQKNSKVYRCLSEVLGLNDESQLLSVIMRKIITNLKYWGGSEQIIAKTLGLLSDLSGGYSCVRKLVKLDETQLMLTHHTAEHFPFLGIAGVGTAEMRCRTMLYTALGRLLMVELGEDEDTFHTFMMPITAAMESIIGLLGPPESPLFASEDAKKTLIGLARDLRGLAFAFNTKTTYMMLFDWIYPVYIKVLIRGIEVWFAEPALTTPVLKLTAELAQNRNQRLQLDVSSPNGILLFRELSNIICAYGSRILTVDVSKKQMYAMKLKGISLCFSILKAALCGNYANFGVFRLYGDEALDNALNMFVKLLLSIPQSDLHDYPKLSQTYYVLLERLAQDLMPFLASLQPEATLYILASISEGLTALDTSVCTGCCATLDHIVTYLFKQLVQKSSNKPPNPRQPPPEASNM-LQVLQRRPEIMQQLLATVLNVIMFEDCCNQWSMSRPLLGLILLNEEHFARLRGDMLAQQPRDKQPQLAHCFSALMAGVEPNLLTKNRDRFTQNLSIFRRDINDLLKGTLVNTSNVNDMMTS 702
            MVASVPYVKATEPH LETYAPGVTAAYI SRL+SV  VV +GLEDPLD+ GTVQQQLEQLSV+ RCEY K+C+LLVAHFDRAAA YSV+Q PQ+ILVLQGQLTWLVYIIGAAIGGRASV TCDENDAMDGELVCRVLQLMDLTDSRLA GGCEKLELAMMSFFE FRKIYVGEQVQK+SKVYR LSEVLGL DESQLLSV+MRKIITNLKYWGGSEQII+KTLGLLSDLSGGY+CVRKLV L+E Q MLTHHTAEHFPFLGI+GVG +EMRCRTMLYTALGRLLMVELGEDE+ FH FMMP+TAA ESIIGLLGPPESPLFASEDAKKTLIGLARDLRGLAFAFNTKTTYMMLFDWIYPVY+KVL+RG+E WF++P L+TPVLKL AELAQNRNQRL  DVSSPNGILLFRELS  ICAYGSRI+T++V+KK MYAMKLKGIS+CF ILKAALCGNYANFGVFRLYGDEALDNALNMFVKLLL IPQSDL DYPKLSQTYYVLLERLAQD MPFL+SLQPEATLYIL+SISEGLTALDTSVCTGCCATLDHIVTYLFKQLVQK+SNK PNPRQPPPE SNM ++VLQRRPEIMQQLLATVLNVIMFE+CCNQWSMSRPLLGL+LLNEE F+RLR +++++QPRDKQ QLAH FS LMAG+EPNLLTKNRDRFTQNLS FRRDINDLLKG  V++   NDMMTS
Sbjct:  363 MVASVPYVKATEPHQLETYAPGVTAAYIASRLDSVAVVVSEGLEDPLDDVGTVQQQLEQLSVIGRCEYGKTCQLLVAHFDRAAAEYSVEQRPQQILVLQGQLTWLVYIIGAAIGGRASVTTCDENDAMDGELVCRVLQLMDLTDSRLARGGCEKLELAMMSFFEQFRKIYVGEQVQKSSKVYRRLSEVLGLADESQLLSVLMRKIITNLKYWGGSEQIISKTLGLLSDLSGGYACVRKLVTLEEVQFMLTHHTAEHFPFLGISGVGPSEMRCRTMLYTALGRLLMVELGEDEERFHAFMMPLTAAFESIIGLLGPPESPLFASEDAKKTLIGLARDLRGLAFAFNTKTTYMMLFDWIYPVYLKVLLRGLEAWFSQPELSTPVLKLAAELAQNRNQRLHFDVSSPNGILLFRELSAFICAYGSRIVTIEVNKKDMYAMKLKGISVCFCILKAALCGNYANFGVFRLYGDEALDNALNMFVKLLLHIPQSDLLDYPKLSQTYYVLLERLAQDHMPFLSSLQPEATLYILSSISEGLTALDTSVCTGCCATLDHIVTYLFKQLVQKTSNKVPNPRQPPPETSNMFVEVLQRRPEIMQQLLATVLNVIMFEECCNQWSMSRPLLGLVLLNEEQFSRLRAELISRQPRDKQAQLAHWFSNLMAGIEPNLLTKNRDRFTQNLSTFRRDINDLLKGANVSSQQSNDMMTS 1065          
BLAST of HiSeq36547 vs. genbank:protein
Match: gi|913324935|ref|XP_013193815.1| (PREDICTED: exportin-7-B [Amyelois transitella])

HSP 1 Score: 1280 bits (3311), Expect = 0.000e+0
Identity = 611/703 (86.91%), Postives = 657/703 (93.46%), Query Frame = 0
Query:    1 MVASVPYVKATEPHLLETYAPGVTAAYIESRLNSVPCVVRDGLEDPLDEAGTVQQQLEQLSVVARCEYAKSCRLLVAHFDRAAAAYSVQQNPQEILVLQGQLTWLVYIIGAAIGGRASVNTCDENDAMDGELVCRVLQLMDLTDSRLASGGCEKLELAMMSFFEHFRKIYVGEQVQKNSKVYRCLSEVLGLNDESQLLSVIMRKIITNLKYWGGSEQIIAKTLGLLSDLSGGYSCVRKLVKLDETQLMLTHHTAEHFPFLGIAGVGTAEMRCRTMLYTALGRLLMVELGEDEDTFHTFMMPITAAMESIIGLLGPPESPLFASEDAKKTLIGLARDLRGLAFAFNTKTTYMMLFDWIYPVYIKVLIRGIEVWFAEPALTTPVLKLTAELAQNRNQRLQLDVSSPNGILLFRELSNIICAYGSRILTVDVSKKQMYAMKLKGISLCFSILKAALCGNYANFGVFRLYGDEALDNALNMFVKLLLSIPQSDLHDYPKLSQTYYVLLERLAQDLMPFLASLQPEATLYILASISEGLTALDTSVCTGCCATLDHIVTYLFKQLVQKSSNKPPNPRQPPPEASNM-LQVLQRRPEIMQQLLATVLNVIMFEDCCNQWSMSRPLLGLILLNEEHFARLRGDMLAQQPRDKQPQLAHCFSALMAGVEPNLLTKNRDRFTQNLSIFRRDINDLLKGTLVNTSNVNDMMTS 702
            MVASVPYVKA+EPHLL+ YAPGVTAAYI SRL+ V  VV +GLEDPLDE GTVQQQLEQLSV+ RCEYAK+C+LLVAHFDRAAA YSV+  PQ+ L+LQGQLTWLVYIIGAAIGGRAS  TCD+NDAMDGELVCRVLQLM LTDSRLA+GGCEKLELAMMSFFE FR+IYVGEQVQKNSKVYR LSEVLGL+DESQLLSV+MRKIITNLKYWGGSEQIIAKTLGLLSDLSGGYSCVRKLVKL+ETQ MLTHHTAEHFPFLGI GVGT+EMRCRTMLYTALGRLLMVELGEDE+ FH FMMP+TAA ESIIGLLG  ES +FASE+A+KTLIGLARDLRGLAFAFNTKTTYMMLFDWIYPVY+KVL+RGIE+WFAEP+LTTPVLKL AELAQNRNQRL  DVSSPNGILLFRELS IICAYGSRILT+DVSKKQMYAMKLKGISLCFSILKAALCGNYANFGVFRLYGDEALDNALNMFVKLLLSIPQSDL DYPKLSQTYYVLLERLAQD MPFLASLQP ATLYIL S+SEGLTALDTSVCTGCCATLDHIVTYLFKQLVQKS++KP NPRQPPP+ SNM +++LQRRPEIMQQLLATVLNVIMFEDCCNQWSMSRPLLGLILLNEEHF+R+RG+M++QQPRDKQ QLA  F+ LM  +EPNLLTKNRDRFTQNLS+FRRDINDLL+G + +  +VNDMMTS
Sbjct:  389 MVASVPYVKASEPHLLDAYAPGVTAAYIGSRLDCVAAVVTEGLEDPLDEVGTVQQQLEQLSVIGRCEYAKTCQLLVAHFDRAAATYSVENRPQQTLILQGQLTWLVYIIGAAIGGRASATTCDDNDAMDGELVCRVLQLMTLTDSRLANGGCEKLELAMMSFFEQFRRIYVGEQVQKNSKVYRRLSEVLGLSDESQLLSVLMRKIITNLKYWGGSEQIIAKTLGLLSDLSGGYSCVRKLVKLEETQFMLTHHTAEHFPFLGIVGVGTSEMRCRTMLYTALGRLLMVELGEDEERFHAFMMPLTAAFESIIGLLGGSESAVFASEEARKTLIGLARDLRGLAFAFNTKTTYMMLFDWIYPVYMKVLLRGIELWFAEPSLTTPVLKLAAELAQNRNQRLHFDVSSPNGILLFRELSAIICAYGSRILTIDVSKKQMYAMKLKGISLCFSILKAALCGNYANFGVFRLYGDEALDNALNMFVKLLLSIPQSDLLDYPKLSQTYYVLLERLAQDHMPFLASLQPPATLYILCSVSEGLTALDTSVCTGCCATLDHIVTYLFKQLVQKSNSKPHNPRQPPPQTSNMFVELLQRRPEIMQQLLATVLNVIMFEDCCNQWSMSRPLLGLILLNEEHFSRIRGEMISQQPRDKQAQLAQWFNGLMNEIEPNLLTKNRDRFTQNLSMFRRDINDLLRGAVSSQPSVNDMMTS 1091          
BLAST of HiSeq36547 vs. genbank:protein
Match: gi|909558241|ref|XP_013134125.1| (PREDICTED: exportin-7-B [Papilio polytes])

HSP 1 Score: 1241.87 bits (3212), Expect = 0.000e+0
Identity = 603/703 (85.78%), Postives = 650/703 (92.46%), Query Frame = 0
Query:    1 MVASVPYVKATEPHLLETYAPGVTAAYIESRLNSVPCVVRDGLEDPLDEAGTVQQQLEQLSVVARCEYAKSCRLLVAHFDRAAAAYSVQQNPQEILVLQGQLTWLVYIIGAAIGGRASVNTCDENDAMDGELVCRVLQLMDLTDSRLASGGCEKLELAMMSFFEHFRKIYVGEQVQKNSKVYRCLSEVLGLNDESQLLSVIMRKIITNLKYWGGSEQIIAKTLGLLSDLSGGYSCVRKLVKLDETQLMLTHHTAEHFPFLGIAGVGTAEMRCRTMLYTALGRLLMVELGEDEDTFHTFMMPITAAMESIIGLLGPPESPLFASEDAKKTLIGLARDLRGLAFAFNTKTTYMMLFDWIYPVYIKVLIRGIEVWFAEPALTTPVLKLTAELAQNRNQRLQLDVSSPNGILLFRELSNIICAYGSRILTVDVSKKQMYAMKLKGISLCFSILKAALCGNYANFGVFRLYGDEALDNALNMFVKLLLSIPQSDLHDYPKLSQTYYVLLERLAQDLMPFLASLQPEATLYILASISEGLTALDTSVCTGCCATLDHIVTYLFKQLVQKSSNKPPNPRQPPPEASNM-LQVLQRRPEIMQQLLATVLNVIMFEDCCNQWSMSRPLLGLILLNEEHFARLRGDMLAQQPRDKQPQLAHCFSALMAGVEPNLLTKNRDRFTQNLSIFRRDINDLLKGTLVNTSNVNDMMTS 702
            MVASVPYVKATEPH LE YAPGVTAAYI SRL+SV  +V +G+EDPL+EAGTVQQQLEQL+V+ RCEY K+C+LLVAHFDRAAA YSV+Q PQ++LVLQGQL+WLVYIIGAAIGGRASV TCDENDAMDGELVCRVLQLMDLTDSRLA GGCEKLELAMMSFFE FRKIYVGEQVQK+SKVYR LSEVLGL DESQLLSV+MRKIITNLKYWGGSE II+KTLGLLSDLSGGY+CVRKLV L+E Q MLTHHTAEHFPFLGI+GVG +EMRCRTMLYTALGRLLMVELGEDE+ FH FMMP+TAA ESIIGLLGPPESPLFASEDAKKTLIGLARDLRGLAFAFNTKTTYMMLFDWIYPVY+KV +RG+E WFA+P L+TP+LKL AELA NRNQRL  DVSSPNGILLFRELS  ICAYGSRI+T++V KK MYAMKLKGIS+CF ILKAALCGNYANFGVFRLYGDEALDNALNMFVKLLL IPQSDL DYPKLSQTYYVLLERLAQD MPFL+SLQPEATLYIL+SISEGLTALDTSVCTGCCATLDHIVTYLFKQLVQK+SNK  NPRQPPPE SNM ++VLQRRPEIMQQLLATVLNVIMFE+CCNQWSMSRPLLGL+LLNEE F+RLR +++A+QPRDKQPQLAH F+ LMAG+EPNLLTKNRDRFTQNLS FRRDINDLLKG  V   + NDMMTS
Sbjct:  333 MVASVPYVKATEPHRLEQYAPGVTAAYITSRLDSVAVIVSEGVEDPLEEAGTVQQQLEQLAVIGRCEYGKTCQLLVAHFDRAAAEYSVEQRPQQLLVLQGQLSWLVYIIGAAIGGRASVTTCDENDAMDGELVCRVLQLMDLTDSRLARGGCEKLELAMMSFFEQFRKIYVGEQVQKSSKVYRRLSEVLGLADESQLLSVLMRKIITNLKYWGGSEPIISKTLGLLSDLSGGYACVRKLVTLEEVQFMLTHHTAEHFPFLGISGVGPSEMRCRTMLYTALGRLLMVELGEDEERFHAFMMPLTAAFESIIGLLGPPESPLFASEDAKKTLIGLARDLRGLAFAFNTKTTYMMLFDWIYPVYLKVALRGLEAWFAQPELSTPLLKLAAELAHNRNQRLHFDVSSPNGILLFRELSAFICAYGSRIVTIEVGKKDMYAMKLKGISVCFCILKAALCGNYANFGVFRLYGDEALDNALNMFVKLLLHIPQSDLLDYPKLSQTYYVLLERLAQDHMPFLSSLQPEATLYILSSISEGLTALDTSVCTGCCATLDHIVTYLFKQLVQKTSNKVGNPRQPPPETSNMFVEVLQRRPEIMQQLLATVLNVIMFEECCNQWSMSRPLLGLVLLNEEQFSRLRAELIARQPRDKQPQLAHWFANLMAGIEPNLLTKNRDRFTQNLSTFRRDINDLLKGANVAQQS-NDMMTS 1034          
BLAST of HiSeq36547 vs. genbank:protein
Match: gi|910311620|ref|XP_013164865.1| (PREDICTED: LOW QUALITY PROTEIN: exportin-7-B [Papilio xuthus])

HSP 1 Score: 1222.22 bits (3161), Expect = 0.000e+0
Identity = 593/711 (83.40%), Postives = 637/711 (89.59%), Query Frame = 0
Query:    1 MVASVPYVKATEPHLLETYAPGVTAAYIESRLNSVPCVVRDGLEDPLDEAGTVQQQLEQLSVVARCEYAKSCRLLVAHFDRAAAAYSVQQNPQEILVLQGQLTWLVYIIGAAIGGRASVNTCDENDAMDGELVCRVLQLMDLTDSRLASGGCEKLELAMMSFFEHFRKIYVGEQVQKNSKVYRCLSEVLGLNDESQLLSVIMRKIITNLKYWGGSEQIIAKTLGLLSDLSGGYSCVRKLVKLDETQLMLTHHTAEHFPFLGIAGVGTAEMRCRTMLYTALGRLLMVELGEDEDTFHTFMMPITAAMESIIGLLGPPESPLFASEDAKKTLIGLARDLRGLAFAFNTKTTYMMLFDWI-------YPVYIKVLIR-GIEVWFAEPALTTPVLKLTAELAQNRNQRLQLDVSSPNGILLFRELSNIICAYGSRILTVDVSKKQMYAMKLKGISLCFSILKAALCGNYANFGVFRLYGDEALDNALNMFVKLLLSIPQSDLHDYPKLSQTYYVLLERLAQDLMPFLASLQPEATLYILASISEGLTALDTSVCTGCCATLDHIVTYLFKQLVQKSSNKPPNPRQPPPEASNM-LQVLQRRPEIMQQLLATVLNVIMFEDCCNQWSMSRPLLGLILLNEEHFARLRGDMLAQQPRDKQPQLAHCFSALMAGVEPNLLTKNRDRFTQNLSIFRRDINDLLKGTLVNTSNVNDMMTS 702
            MVASVPYVKATEPH LETYAPGVTAAYI SRL+SV  VV +GLEDPLDE GTVQQQLEQLSV+ RCEY K+C+LLVAHFDRAAA YSV+Q PQ+ILVLQGQLTWLVYIIGAAIGGRASV TCDENDAMDGELVCRVLQLMDLTDSRLA GGCEKLELAMMSFFE FRKIYVGEQVQK+SKVYR LSEVLGL DESQLLSV+MRKIITNLKYWGGSEQII+KTLGLLSDLSGGY+CVRKLV L+E Q MLTHHTAEHFPFLGI+GVG +EMRCRTMLYTALGRLLMVELGEDE+ FH FMMP+TAA ESIIGLLGPPESPLFASEDAKKTLIGLARDLRGLAFAFNTKTTYMMLFDW+        P + ++L + G+   F     +     + A +  NRNQRL  DVSSPNGILLFRELS  ICAYGSRI+T++VSKK MYAMKLKGIS+CF ILKAALCGNYANFGVFRLYGDEALDNALNMFVKLLL IPQSDL DYPKLSQTYYVLLERLAQD MPFL+SLQPEATLYIL+SISEGLTALDTSVCTGCCATLDHIVTYLFKQLVQK+SNK PNPRQPPPE SNM ++VLQRRPEIMQQLLATVLNVIMFE+CCNQWSMSRPLLGL+LLNEE F+RLR D++++QPRDKQ QLAH FS LMAG+EPNLLTKNRDRFTQNLS FRRDINDLLKG  V++   NDMMTS
Sbjct:  384 MVASVPYVKATEPHQLETYAPGVTAAYIASRLDSVAVVVSEGLEDPLDEVGTVQQQLEQLSVIGRCEYGKTCQLLVAHFDRAAAEYSVEQRPQQILVLQGQLTWLVYIIGAAIGGRASVTTCDENDAMDGELVCRVLQLMDLTDSRLARGGCEKLELAMMSFFEQFRKIYVGEQVQKSSKVYRRLSEVLGLADESQLLSVLMRKIITNLKYWGGSEQIISKTLGLLSDLSGGYACVRKLVTLEEVQFMLTHHTAEHFPFLGISGVGPSEMRCRTMLYTALGRLLMVELGEDEERFHAFMMPLTAAFESIIGLLGPPESPLFASEDAKKTLIGLARDLRGLAFAFNTKTTYMMLFDWMXVAGGTAVPTHTEILCQLGVXSIFNSGRAS---FNIFARIVXNRNQRLHFDVSSPNGILLFRELSAFICAYGSRIVTIEVSKKDMYAMKLKGISVCFCILKAALCGNYANFGVFRLYGDEALDNALNMFVKLLLHIPQSDLLDYPKLSQTYYVLLERLAQDHMPFLSSLQPEATLYILSSISEGLTALDTSVCTGCCATLDHIVTYLFKQLVQKTSNKVPNPRQPPPETSNMFVEVLQRRPEIMQQLLATVLNVIMFEECCNQWSMSRPLLGLVLLNEEQFSRLRADLISRQPRDKQAQLAHWFSNLMAGIEPNLLTKNRDRFTQNLSTFRRDINDLLKGANVSSHQNNDMMTS 1091          
BLAST of HiSeq36547 vs. genbank:protein
Match: gi|1073538913|gb|JAT86568.1| (hypothetical protein g.15319, partial [Pectinophora gossypiella])

HSP 1 Score: 1203.35 bits (3112), Expect = 0.000e+0
Identity = 578/646 (89.47%), Postives = 609/646 (94.27%), Query Frame = 0
Query:   58 EQLSVVARCEYAKSCRLLVAHFDRAAAAYSVQQNPQEILVLQGQLTWLVYIIGAAIGGRASVNTCDENDAMDGELVCRVLQLMDLTDSRLASGGCEKLELAMMSFFEHFRKIYVGEQVQKNSKVYRCLSEVLGLNDESQLLSVIMRKIITNLKYWGGSEQIIAKTLGLLSDLSGGYSCVRKLVKLDETQLMLTHHTAEHFPFLGIAGVGTAEMRCRTMLYTALGRLLMVELGEDEDTFHTFMMPITAAMESIIGLLGPPESPLFASEDAKKTLIGLARDLRGLAFAFNTKTTYMMLFDWIYPVYIKVLIRGIEVWFAEPALTTPVLKLTAELAQNRNQRLQLDVSSPNGILLFRELSNIICAYGSRILTVDVSKKQMYAMKLKGISLCFSILKAALCGNYANFGVFRLYGDEALDNALNMFVKLLLSIPQSDLHDYPKLSQTYYVLLERLAQDLMPFLASLQPEATLYILASISEGLTALDTSVCTGCCATLDHIVTYLFKQLVQKSSNKPPNPRQPPPEASNM-LQVLQRRPEIMQQLLATVLNVIMFEDCCNQWSMSRPLLGLILLNEEHFARLRGDMLAQQPRDKQPQLAHCFSALMAGVEPNLLTKNRDRFTQNLSIFRRDINDLLKGTLVNT-SNVNDMMT 701
            EQLSV+  CEY K+C+LLVAHFDRAAAAYSV   PQ+  VLQGQLTWLVYIIGAAIGGRASVNTCDENDAMDGELVCRVLQLMDLTDSRLA GGCEKLELAMMSFFE FRKIYVGEQVQKNSKVYR LSEVLGL++ESQLLSV+MRKIITNLKYWGGSEQ+IA+TLGLLSDLSGGYSCVRKLVKLDE QLMLTHHTAEHFPFLGI GVGT+EMRCRTMLYTALGRLLMVELGEDED FH FMMP+TAA ESIIGLLGPPESP+FASEDAKKTLIGLARDLRGLAFAFNTKTTYMMLFDWIYP Y+++L+RGIE+WFAEP +TTPVLKLTAELAQNRNQRL  DVSSPNGILLFRELS +ICAYGSRILT+DVSKKQMY+MKLKGISLCFSILKAALCGNYANFGVFRLYGDEALDNALNMFVKLLLSIPQ+DL DYPKLSQTYYVLLERLAQD MPFLASLQPEATLYIL SISEGLTALDTSVCTGCCATLDHIVTYLFKQLVQKSSNK  NPRQPPPE+SNM ++VLQRRPEIMQQLLATVLNVIMFEDCCNQWSMSRPLLGLILLNE  FAR+R +M+AQQPRDKQ QLA  FS LM G+EPNLLTKNRDRFTQNLS+FRRDINDLLKGT VNT S+VNDMMT
Sbjct:    1 EQLSVIGSCEYGKTCQLLVAHFDRAAAAYSVDTTPQQTRVLQGQLTWLVYIIGAAIGGRASVNTCDENDAMDGELVCRVLQLMDLTDSRLARGGCEKLELAMMSFFEQFRKIYVGEQVQKNSKVYRRLSEVLGLHEESQLLSVLMRKIITNLKYWGGSEQMIARTLGLLSDLSGGYSCVRKLVKLDEVQLMLTHHTAEHFPFLGITGVGTSEMRCRTMLYTALGRLLMVELGEDEDKFHAFMMPLTAAFESIIGLLGPPESPIFASEDAKKTLIGLARDLRGLAFAFNTKTTYMMLFDWIYPCYMQILLRGIELWFAEPTVTTPVLKLTAELAQNRNQRLHFDVSSPNGILLFRELSKVICAYGSRILTIDVSKKQMYSMKLKGISLCFSILKAALCGNYANFGVFRLYGDEALDNALNMFVKLLLSIPQNDLLDYPKLSQTYYVLLERLAQDHMPFLASLQPEATLYILCSISEGLTALDTSVCTGCCATLDHIVTYLFKQLVQKSSNKVSNPRQPPPESSNMFIEVLQRRPEIMQQLLATVLNVIMFEDCCNQWSMSRPLLGLILLNESQFARIRSEMIAQQPRDKQAQLAQWFSGLMQGIEPNLLTKNRDRFTQNLSMFRRDINDLLKGTAVNTSSSVNDMMT 646          
BLAST of HiSeq36547 vs. genbank:protein
Match: gi|1080039372|ref|XP_018580214.1| (PREDICTED: exportin-7 isoform X2 [Anoplophora glabripennis])

HSP 1 Score: 1059.28 bits (2738), Expect = 0.000e+0
Identity = 519/706 (73.51%), Postives = 588/706 (83.29%), Query Frame = 0
Query:    1 MVASVPYVKATEPHLLETYAPGVTAAYIESRLNSVPCVVRDGLEDPLDEAGTVQQQLEQLSVVARCEYAKSCRLLVAHFDRAAAAYS----VQQNPQEILVLQGQLTWLVYIIGAAIGGRASVNTCDENDAMDGELVCRVLQLMDLTDSRLASGGCEKLELAMMSFFEHFRKIYVGEQVQKNSKVYRCLSEVLGLNDESQLLSVIMRKIITNLKYWGGSEQIIAKTLGLLSDLSGGYSCVRKLVKLDETQLMLTHHTAEHFPFLGIAGVGTAEMRCRTMLYTALGRLLMVELGEDEDTFHTFMMPITAAMESIIGLLGPPESPLFASEDAKKTLIGLARDLRGLAFAFNTKTTYMMLFDWIYPVYIKVLIRGIEVWFAEPALTTPVLKLTAELAQNRNQRLQLDVSSPNGILLFRELSNIICAYGSRILTVDVSKKQMYAMKLKGISLCFSILKAALCGNYANFGVFRLYGDEALDNALNMFVKLLLSIPQSDLHDYPKLSQTYYVLLERLAQDLMPFLASLQPEATLYILASISEGLTALDTSVCTGCCATLDHIVTYLFKQLVQKSSNKPPNPRQPPPEASNMLQVLQRRPEIMQQLLATVLNVIMFEDCCNQWSMSRPLLGLILLNEEHFARLRGDMLAQQPRDKQPQLAHCFSALMAGVEPNLLTKNRDRFTQNLSIFRRDINDLLKGTLVNTSNVNDMMTS 702
            MVASVPYVKATEPHLLETY P VT AYI SRL SV  VVRDGLEDPLD+ G VQQQLEQLSV+ RCEY K+C LLV  FD+AA +YS       N  EI + +GQLTWLVYIIG+AIGGR S N+ +E+D MDGELVCRVLQLM+LTDSRLA GGCEKLELAM+SFFE FRKIYVG+QVQKNSKVYR LSEVLGLNDE  +LSV +RKIITNLKYWG SEQII+KTL LL+DLS GYSCVRKLVKLDE Q ML +HT+EHFPFLG   V   EMRCR+M YT+LGRLLMV+LGEDED FHTFM+P+TA+ ESI  LL   ++PLFA+++AKK LIGLARDLRGLAF+FNTKT+YMMLFDWIYP Y  +L+R IE+W+ +P +TTPVLKL AEL QNR+QRLQ DVSSPNGILLFRE S IIC+YGSRIL V+V K+Q Y +KLKGIS+CFS+LKAALCG+Y NFGVFRLYGDEALDNALN+FVKLLLSIPQSDL DYPKLSQ YYVLLE LAQD M FL++L+P   LYIL+SISEGLTALDT VCTGCCATLDHIVTYLFKQL QK            P +   L+VL+  PEI+QQ+L+TVLNVIMFEDC NQWSMSRPLLGLILLNEE+F ++R +++  QP DKQ  +A  F  LM G+E NLLTKNRDRFTQNLS+FRRDIND LKG  VNTS+V+DMMTS
Sbjct:  391 MVASVPYVKATEPHLLETYTPEVTNAYITSRLESVAVVVRDGLEDPLDDLGMVQQQLEQLSVIGRCEYQKTCTLLVQLFDQAARSYSELLASPSNQIEITIQEGQLTWLVYIIGSAIGGRVSFNSNEEHDTMDGELVCRVLQLMNLTDSRLAQGGCEKLELAMLSFFEQFRKIYVGDQVQKNSKVYRRLSEVLGLNDEPTVLSVFIRKIITNLKYWGRSEQIISKTLQLLNDLSVGYSCVRKLVKLDEVQFMLNNHTSEHFPFLG-NSVAITEMRCRSMFYTSLGRLLMVDLGEDEDRFHTFMLPLTASFESIGTLLASADTPLFAADEAKKALIGLARDLRGLAFSFNTKTSYMMLFDWIYPNYTPILLRAIELWYHDPQVTTPVLKLFAELVQNRSQRLQFDVSSPNGILLFREASKIICSYGSRILNVEVPKEQTYPLKLKGISICFSMLKAALCGSYVNFGVFRLYGDEALDNALNIFVKLLLSIPQSDLLDYPKLSQIYYVLLECLAQDHMSFLSTLEPHVFLYILSSISEGLTALDTMVCTGCCATLDHIVTYLFKQLTQKVYPGKEARVGMAPSSDMFLKVLEMHPEILQQILSTVLNVIMFEDCRNQWSMSRPLLGLILLNEEYFNQMRENIIRSQPPDKQAAMAQWFENLMDGIERNLLTKNRDRFTQNLSMFRRDINDSLKGPNVNTSSVSDMMTS 1095          
BLAST of HiSeq36547 vs. genbank:protein
Match: gi|1080039370|ref|XP_018580213.1| (PREDICTED: exportin-7 isoform X1 [Anoplophora glabripennis])

HSP 1 Score: 1051.2 bits (2717), Expect = 0.000e+0
Identity = 519/714 (72.69%), Postives = 588/714 (82.35%), Query Frame = 0
Query:    1 MVASVPYVKATEPHLLETYAPGVTAAYIESRLNSVPCVVRDGLEDPLDEAGTVQQQLEQLSVVARCEYAKSCRLLVAHFDRAAAAYS----VQQNPQEILVLQGQLTWLVYIIGAAIGGRASVNTCDENDAMDGELVCRVLQLMDLTDSRLASGGCEKLELAMMSFFEHFRKIYVGEQVQKNSKVYRCLSEVLGLNDESQLLSVIMRKIITNLKYWGGSEQIIAKTLGLLSDLSGGYSCVRKLVKLDETQLMLTHHTAEHFPFLGIAGVGTAEMRCRTMLYTALGRLLMVELGEDEDTFHTFMMPITAAMESIIGLLGPPESPLFASEDAKKTLIGLARDLRGLAFAFNTKTTYMMLFDWIYPVYIKVLIRGIEVWFAEPALTTPVLKLTAELAQNRNQRLQLDVSSPNGILLFRELSNIICAYGSRILTVDVSKKQMYAMKLKGISLCFSILKAALCGNYANFGVFRLYGDEALDNALNMFVKLLLSIPQSDLHDYPKLSQTYYVLLERLAQDLMPFLASLQPEATLYILASISEGLTAL--------DTSVCTGCCATLDHIVTYLFKQLVQKSSNKPPNPRQPPPEASNMLQVLQRRPEIMQQLLATVLNVIMFEDCCNQWSMSRPLLGLILLNEEHFARLRGDMLAQQPRDKQPQLAHCFSALMAGVEPNLLTKNRDRFTQNLSIFRRDINDLLKGTLVNTSNVNDMMTS 702
            MVASVPYVKATEPHLLETY P VT AYI SRL SV  VVRDGLEDPLD+ G VQQQLEQLSV+ RCEY K+C LLV  FD+AA +YS       N  EI + +GQLTWLVYIIG+AIGGR S N+ +E+D MDGELVCRVLQLM+LTDSRLA GGCEKLELAM+SFFE FRKIYVG+QVQKNSKVYR LSEVLGLNDE  +LSV +RKIITNLKYWG SEQII+KTL LL+DLS GYSCVRKLVKLDE Q ML +HT+EHFPFLG   V   EMRCR+M YT+LGRLLMV+LGEDED FHTFM+P+TA+ ESI  LL   ++PLFA+++AKK LIGLARDLRGLAF+FNTKT+YMMLFDWIYP Y  +L+R IE+W+ +P +TTPVLKL AEL QNR+QRLQ DVSSPNGILLFRE S IIC+YGSRIL V+V K+Q Y +KLKGIS+CFS+LKAALCG+Y NFGVFRLYGDEALDNALN+FVKLLLSIPQSDL DYPKLSQ YYVLLE LAQD M FL++L+P   LYIL+SISEGLTAL        DT VCTGCCATLDHIVTYLFKQL QK            P +   L+VL+  PEI+QQ+L+TVLNVIMFEDC NQWSMSRPLLGLILLNEE+F ++R +++  QP DKQ  +A  F  LM G+E NLLTKNRDRFTQNLS+FRRDIND LKG  VNTS+V+DMMTS
Sbjct:  391 MVASVPYVKATEPHLLETYTPEVTNAYITSRLESVAVVVRDGLEDPLDDLGMVQQQLEQLSVIGRCEYQKTCTLLVQLFDQAARSYSELLASPSNQIEITIQEGQLTWLVYIIGSAIGGRVSFNSNEEHDTMDGELVCRVLQLMNLTDSRLAQGGCEKLELAMLSFFEQFRKIYVGDQVQKNSKVYRRLSEVLGLNDEPTVLSVFIRKIITNLKYWGRSEQIISKTLQLLNDLSVGYSCVRKLVKLDEVQFMLNNHTSEHFPFLG-NSVAITEMRCRSMFYTSLGRLLMVDLGEDEDRFHTFMLPLTASFESIGTLLASADTPLFAADEAKKALIGLARDLRGLAFSFNTKTSYMMLFDWIYPNYTPILLRAIELWYHDPQVTTPVLKLFAELVQNRSQRLQFDVSSPNGILLFREASKIICSYGSRILNVEVPKEQTYPLKLKGISICFSMLKAALCGSYVNFGVFRLYGDEALDNALNIFVKLLLSIPQSDLLDYPKLSQIYYVLLECLAQDHMSFLSTLEPHVFLYILSSISEGLTALGGNLNHFTDTMVCTGCCATLDHIVTYLFKQLTQKVYPGKEARVGMAPSSDMFLKVLEMHPEILQQILSTVLNVIMFEDCRNQWSMSRPLLGLILLNEEYFNQMRENIIRSQPPDKQAAMAQWFENLMDGIERNLLTKNRDRFTQNLSMFRRDINDSLKGPNVNTSSVSDMMTS 1103          
BLAST of HiSeq36547 vs. genbank:protein
Match: gi|642912276|ref|XP_008200634.1| (PREDICTED: exportin-7 isoform X2 [Tribolium castaneum] >gi|270002549|gb|EEZ98996.1| Ran-binding protein 16-like Protein [Tribolium castaneum])

HSP 1 Score: 1040.8 bits (2690), Expect = 0.000e+0
Identity = 512/713 (71.81%), Postives = 587/713 (82.33%), Query Frame = 0
Query:    1 MVASVPYVKATEPHLLETYAPGVTAAYIESRLNSVPCVVRDGLEDPLDEAGTVQQQLEQLSVVARCEYAKSCRLLVAHFDRAAAAYSV------QQNPQ--EILVLQGQLTWLVYIIGAAIGGRASVNTCDENDAMDGELVCRVLQLMDLTDSRLASGGCEKLELAMMSFFEHFRKIYVGEQVQKNSKVYRCLSEVLGLNDESQLLSVIMRKIITNLKYWGGSEQIIAKTLGLLSDLSGGYSCVRKLVKLDETQLMLTHHTAEHFPFLGIAGVGTAEMRCRTMLYTALGRLLMVELGEDEDTFHTFMMPITAAMESIIGLLGPPESPLFASEDAKKTLIGLARDLRGLAFAFNTKTTYMMLFDWIYPVYIKVLIRGIEVWFAEPALTTPVLKLTAELAQNRNQRLQLDVSSPNGILLFRELSNIICAYGSRILTVDVSKKQMYAMKLKGISLCFSILKAALCGNYANFGVFRLYGDEALDNALNMFVKLLLSIPQSDLHDYPKLSQTYYVLLERLAQDLMPFLASLQPEATLYILASISEGLTALDTSVCTGCCATLDHIVTYLFKQLVQKSSNKPPNPRQP---PPEASNMLQVLQRRPEIMQQLLATVLNVIMFEDCCNQWSMSRPLLGLILLNEEHFARLRGDMLAQQPRDKQPQLAHCFSALMAGVEPNLLTKNRDRFTQNLSIFRRDINDLLKGTLVNTSNVNDMMTS 702
            MVASVPYVKATEPHLLETY P VT AYI SRL SV  VV++ LEDPL++ G VQQQLEQLSV+ RCEY K+C LLV  FD+AA  Y           PQ  EI + +G+LTWLVYIIG+AIGGR S N+ +E+D MDGELVCRVLQLM+LTDSRLA GGCEKLELAM+SFFE FRKIYVG+QVQKNSKVYR LSEVLGLNDE+ +LSV +RKIITNLKYWG SEQII+KTL LL+DLS GYSCVRKLVKL+E Q ML +HT+EHFPFLG   V   EMRCR+M YT+LGRLLMV+LGEDED FHTFM+P+TAA E+I  +L   + P+FA EDAKK LIGLARDLRGLAF+FNTKT+YMMLFDWIYP Y  +L+R IE+W+ +P +TTPVLKL AEL QNR+QRLQ DVSSPNGILLFRE S IIC+YGSRIL V+V K+Q Y +KLKGIS+CFS+LKAALCG+Y NFGVFRLYGDE LDNALN+FVKLLLSIPQSDL DYPKLSQTYYVLLE LAQD M FL++L+P+  LYIL+SISEGLTALDT VCTGCCATLDHIVTYLFKQL QK     P  +Q     P +   L+VL+  PEI+QQ+L+TVLNVIMFEDC NQWSMSRPLLGLILLNEE+F ++R +++  QP DKQ  +   F  LM G+E NLLTKNRD+FTQNLS+FRRDIND LKG  VNTS+ +DMMTS
Sbjct:  391 MVASVPYVKATEPHLLETYTPEVTNAYITSRLESVAVVVQENLEDPLEDLGMVQQQLEQLSVIGRCEYQKTCTLLVQLFDQAARTYQELMAIPRSNAPQHVEITIQEGRLTWLVYIIGSAIGGRVSFNSNEEHDTMDGELVCRVLQLMNLTDSRLAQGGCEKLELAMLSFFEQFRKIYVGDQVQKNSKVYRRLSEVLGLNDEATVLSVFIRKIITNLKYWGRSEQIISKTLQLLNDLSVGYSCVRKLVKLEEVQFMLNNHTSEHFPFLG-NTVNVTEMRCRSMFYTSLGRLLMVDLGEDEDRFHTFMLPLTAAFENIGTMLAGADGPMFAPEDAKKALIGLARDLRGLAFSFNTKTSYMMLFDWIYPNYTPILLRAIELWYHDPQVTTPVLKLFAELVQNRSQRLQFDVSSPNGILLFREASKIICSYGSRILNVEVPKEQTYPLKLKGISICFSMLKAALCGSYVNFGVFRLYGDETLDNALNIFVKLLLSIPQSDLLDYPKLSQTYYVLLECLAQDHMSFLSTLEPQVFLYILSSISEGLTALDTMVCTGCCATLDHIVTYLFKQLTQKVY---PGKKQRVGLAPNSDMFLKVLEMHPEILQQILSTVLNVIMFEDCRNQWSMSRPLLGLILLNEEYFNQMRENIIRSQPPDKQAAMVQWFENLMDGIERNLLTKNRDKFTQNLSMFRRDINDSLKGPNVNTSSASDMMTS 1099          
BLAST of HiSeq36547 vs. genbank:protein
Match: gi|1000744365|ref|XP_015594892.1| (PREDICTED: exportin-7 isoform X3 [Cephus cinctus])

HSP 1 Score: 1040.02 bits (2688), Expect = 0.000e+0
Identity = 505/710 (71.13%), Postives = 588/710 (82.82%), Query Frame = 0
Query:    1 MVASVPYVKATEPHLLETYAPGVTAAYIESRLNSVPCVVRDGLEDPLDEAGTVQQQLEQLSVVARCEYAKSCRLLVAHFDRAAAAY-------SVQQNPQEILVLQGQLTWLVYIIGAAIGGRASVNTCDENDAMDGELVCRVLQLMDLTDSRLASGGCEKLELAMMSFFEHFRKIYVGEQVQKNSKVYRCLSEVLGLNDESQLLSVIMRKIITNLKYWGGSEQIIAKTLGLLSDLSGGYSCVRKLVKLDETQLMLTHHTAEHFPFLGIAGVGTAEMRCRTMLYTALGRLLMVELGEDEDTFHTFMMPITAAMESIIGLLGPPESPLFASEDAKKTLIGLARDLRGLAFAFNTKTTYMMLFDWIYPVYIKVLIRGIEVWFAEPALTTPVLKLTAELAQNRNQRLQLDVSSPNGILLFRELSNIICAYGSRILTVDVSKKQMYAMKLKGISLCFSILKAALCGNYANFGVFRLYGDEALDNALNMFVKLLLSIPQSDLHDYPKLSQTYYVLLERLAQDLMPFLASLQPEATLYILASISEGLTALDTSVCTGCCATLDHIVTYLFKQLVQKSSNKPPNPRQPPPEASNM-LQVLQRRPEIMQQLLATVLNVIMFEDCCNQWSMSRPLLGLILLNEEHFARLRGDMLAQQPRDKQPQLAHCFSALMAGVEPNLLTKNRDRFTQNLSIFRRDINDLLKGTLVNTSNVNDMMTS 702
            MVASVPYVKATEPHLLETY P V+ AYI SRL SV  VVR+GLEDPLD+ G +QQQLEQLSV+ RCEY K+C LLV  FD+AA  Y       +      +I + +GQLTWLVYIIG+AIGGR S N+ +E+DAMDGELVCRVLQLM+LTDSRLA GGCEKLELAM+SFFE FRKIYVG+Q+QKNSKVYR LSEVLGL+DE+ +LSV +RKIITNLKYWG SEQII+KTL LL+DLS GYSCVRKLVKL+E Q ML +HT+EHFPFLG   V   EMRCR+M YT+LGRLLMV+LGEDE+ FHTFM+P+TAA+ES+  L+G  ++PLFA+E+AKK LIGLARDLRGLA+AFNTK +YMMLFDWIYP Y  +L+  +E+W  EP +TTPVLKL AEL QNR+QRLQ DVSSPNGILLFRE S +IC+YG+ IL V+V K Q+Y +KLKGIS+CFS+LKAALCG+Y NFGVFRLYGDEALDNALN FVKLLLSIPQSDL DYPKLS TYYVLLE LAQD M FL++L+P   LYIL+SISEGLTALDT VCTGCCATLDHIVTYLFKQL QK+   P       P    + LQVL++ PEI+QQ+L+TVLNVIMFEDC NQWSMSRPLLGLILLNEE+F +LR +++  QP DKQ  +A  F  LM G+E NLLTKNRD+FTQNLS+FRRDIND LKG  ++T++V+DMMTS
Sbjct:  391 MVASVPYVKATEPHLLETYTPEVSNAYITSRLESVAVVVREGLEDPLDDLGMIQQQLEQLSVIGRCEYQKTCTLLVQLFDQAARTYQELMAQTATPAQQMDITIQEGQLTWLVYIIGSAIGGRVSFNSNEEHDAMDGELVCRVLQLMNLTDSRLAQGGCEKLELAMLSFFEQFRKIYVGDQIQKNSKVYRRLSEVLGLSDEAMVLSVFIRKIITNLKYWGRSEQIISKTLQLLNDLSVGYSCVRKLVKLEEVQFMLNNHTSEHFPFLG-NSVAVTEMRCRSMFYTSLGRLLMVDLGEDEERFHTFMLPLTAALESLGQLMGAADTPLFAAEEAKKALIGLARDLRGLAYAFNTKNSYMMLFDWIYPNYTPILLHAVELWHHEPQVTTPVLKLFAELVQNRSQRLQFDVSSPNGILLFREASKVICSYGNHILNVEVPKDQVYPLKLKGISICFSMLKAALCGSYVNFGVFRLYGDEALDNALNTFVKLLLSIPQSDLLDYPKLSSTYYVLLECLAQDHMAFLSTLEPRVFLYILSSISEGLTALDTMVCTGCCATLDHIVTYLFKQLYQKAGVYPGKKNAVVPGGGELFLQVLKQHPEILQQILSTVLNVIMFEDCRNQWSMSRPLLGLILLNEEYFNQLRENIIRSQPVDKQATMAQWFENLMDGIERNLLTKNRDKFTQNLSMFRRDINDSLKGPSMSTNSVSDMMTS 1099          
The following BLAST results are available for this feature:
BLAST of HiSeq36547 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|930680160|gb|KPJ19898.1|0.000e+086.91Exportin-7 [Papilio machaon][more]
gi|943935236|ref|XP_014361096.1|0.000e+086.91PREDICTED: exportin-7 [Papilio machaon][more]
gi|913324935|ref|XP_013193815.1|0.000e+086.91PREDICTED: exportin-7-B [Amyelois transitella][more]
gi|909558241|ref|XP_013134125.1|0.000e+085.78PREDICTED: exportin-7-B [Papilio polytes][more]
gi|910311620|ref|XP_013164865.1|0.000e+083.40PREDICTED: LOW QUALITY PROTEIN: exportin-7-B [Papi... [more]
gi|1073538913|gb|JAT86568.1|0.000e+089.47hypothetical protein g.15319, partial [Pectinophor... [more]
gi|1080039372|ref|XP_018580214.1|0.000e+073.51PREDICTED: exportin-7 isoform X2 [Anoplophora glab... [more]
gi|1080039370|ref|XP_018580213.1|0.000e+072.69PREDICTED: exportin-7 isoform X1 [Anoplophora glab... [more]
gi|642912276|ref|XP_008200634.1|0.000e+071.81PREDICTED: exportin-7 isoform X2 [Tribolium castan... [more]
gi|1000744365|ref|XP_015594892.1|0.000e+071.13PREDICTED: exportin-7 isoform X3 [Cephus cinctus][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006886 intracellular protein transport
cellular_component GO:0005622 intracellular
molecular_function GO:0005488 binding
molecular_function GO:0008536 Ran GTPase binding
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR12596:SF7EXPORTIN-7coord: 1..701
NoneNo IPR availablePANTHERPTHR12596EXPORTIN 4,7-RELATEDcoord: 1..701
IPR016024Armadillo-type foldSUPERFAMILY48371ARM repeatcoord: 267..556

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq36547HiSeq36547Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq36547_p ID=HiSeq36547_p|Name=HiSeq36547|organism=Ostrinia scapulalis|type=polypeptide|length=702bp
MVASVPYVKATEPHLLETYAPGVTAAYIESRLNSVPCVVRDGLEDPLDEA
GTVQQQLEQLSVVARCEYAKSCRLLVAHFDRAAAAYSVQQNPQEILVLQG
QLTWLVYIIGAAIGGRASVNTCDENDAMDGELVCRVLQLMDLTDSRLASG
GCEKLELAMMSFFEHFRKIYVGEQVQKNSKVYRCLSEVLGLNDESQLLSV
IMRKIITNLKYWGGSEQIIAKTLGLLSDLSGGYSCVRKLVKLDETQLMLT
HHTAEHFPFLGIAGVGTAEMRCRTMLYTALGRLLMVELGEDEDTFHTFMM
PITAAMESIIGLLGPPESPLFASEDAKKTLIGLARDLRGLAFAFNTKTTY
MMLFDWIYPVYIKVLIRGIEVWFAEPALTTPVLKLTAELAQNRNQRLQLD
VSSPNGILLFRELSNIICAYGSRILTVDVSKKQMYAMKLKGISLCFSILK
AALCGNYANFGVFRLYGDEALDNALNMFVKLLLSIPQSDLHDYPKLSQTY
YVLLERLAQDLMPFLASLQPEATLYILASISEGLTALDTSVCTGCCATLD
HIVTYLFKQLVQKSSNKPPNPRQPPPEASNMLQVLQRRPEIMQQLLATVL
NVIMFEDCCNQWSMSRPLLGLILLNEEHFARLRGDMLAQQPRDKQPQLAH
CFSALMAGVEPNLLTKNRDRFTQNLSIFRRDINDLLKGTLVNTSNVNDMM
TS
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006886intracellular protein transport
Vocabulary: Cellular Component
TermDefinition
GO:0005622intracellular
Vocabulary: Molecular Function
TermDefinition
GO:0008536Ran GTPase binding
GO:0005488binding
Vocabulary: INTERPRO
TermDefinition
IPR016024ARM-type_fold