HiSeq36548_p (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameHiSeq36548
Unique NameHiSeq36548_p
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length365
Homology
BLAST of HiSeq36548 vs. genbank:protein
Match: gi|910346156|ref|XP_013176974.1| (PREDICTED: cullin-1 [Papilio xuthus] >gi|910346158|ref|XP_013176975.1| PREDICTED: cullin-1 [Papilio xuthus])

HSP 1 Score: 738.028 bits (1904), Expect = 0.000e+0
Identity = 355/365 (97.26%), Postives = 362/365 (99.18%), Query Frame = 0
Query:    1 TKAANSSSKSPELLAKYCDLLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYSKMLAKRLVQHMSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNENFRKHMADSSEQPLHIDFSIQVLSSGSWPFQQSSSFQLPTELERSVHRFTAFYSAQHSGRKLNWLYNMSKGELVTNCFKNRYTLQASTFQMAVLLQYNENTAWTVRQLEHHTGIKGDFLLQVLQILLKAKLLVCQDDESELTESSVVELYVGYKNKKLRVNINIPLKTELKVEQEATHKHIEEDRKMLIQAAIVRIMKTRKTLKHQHLVVEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERTEGEKDTYSYLA 365
            TKAANSSSKSPELLAKYCDLLLKKSSKNPE+AELEDTLNQVMVVFKYIEDKDVFQKFYSKMLAKRLVQHMSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNENFRKHMA++SEQPLHIDFSIQVLSSGSWPFQQSSSFQLPTELERSVHRFT FYS+QHSGRKLNWLYNMSKGELVTNCFKNRYTLQASTFQMAVLLQYNENT WTVRQLE HTGIKGDFL+QVLQILLKAKLLVCQDDESELTESSVV+LY+GYKNKKLRVNINIPLKTELKVEQEATHKHIEEDRKMLIQAAIVRIMKTRKTLKHQHLVVEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERTEGEKDTYSYLA
Sbjct:  425 TKAANSSSKSPELLAKYCDLLLKKSSKNPEDAELEDTLNQVMVVFKYIEDKDVFQKFYSKMLAKRLVQHMSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNENFRKHMANTSEQPLHIDFSIQVLSSGSWPFQQSSSFQLPTELERSVHRFTTFYSSQHSGRKLNWLYNMSKGELVTNCFKNRYTLQASTFQMAVLLQYNENTTWTVRQLEQHTGIKGDFLIQVLQILLKAKLLVCQDDESELTESSVVDLYLGYKNKKLRVNINIPLKTELKVEQEATHKHIEEDRKMLIQAAIVRIMKTRKTLKHQHLVVEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERTEGEKDTYSYLA 789          
BLAST of HiSeq36548 vs. genbank:protein
Match: gi|943963491|ref|XP_014364051.1| (PREDICTED: cullin-1 [Papilio machaon])

HSP 1 Score: 737.258 bits (1902), Expect = 0.000e+0
Identity = 354/365 (96.99%), Postives = 362/365 (99.18%), Query Frame = 0
Query:    1 TKAANSSSKSPELLAKYCDLLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYSKMLAKRLVQHMSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNENFRKHMADSSEQPLHIDFSIQVLSSGSWPFQQSSSFQLPTELERSVHRFTAFYSAQHSGRKLNWLYNMSKGELVTNCFKNRYTLQASTFQMAVLLQYNENTAWTVRQLEHHTGIKGDFLLQVLQILLKAKLLVCQDDESELTESSVVELYVGYKNKKLRVNINIPLKTELKVEQEATHKHIEEDRKMLIQAAIVRIMKTRKTLKHQHLVVEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERTEGEKDTYSYLA 365
            TKAANSSSKSPELLAKYCDLLLKKSSKNPE+AELEDTLNQVMVVFKYIEDKDVFQKFYSKMLAKRLVQHMSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNENFRKHMA++SEQPLHIDFSIQVLSSGSWPFQQSSSFQLPTELERSVHRFT FYS+QHSGRKLNWLYNMSKGELVTNCFKNRYTLQASTFQMAVLLQYNENT WTVRQLE HTGIKGDFL+QVLQILLKAKLLVCQDDESELTESSV++LY+GYKNKKLRVNINIPLKTELKVEQEATHKHIEEDRKMLIQAAIVRIMKTRKTLKHQHLVVEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERTEGEKDTYSYLA
Sbjct:  426 TKAANSSSKSPELLAKYCDLLLKKSSKNPEDAELEDTLNQVMVVFKYIEDKDVFQKFYSKMLAKRLVQHMSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNENFRKHMANTSEQPLHIDFSIQVLSSGSWPFQQSSSFQLPTELERSVHRFTTFYSSQHSGRKLNWLYNMSKGELVTNCFKNRYTLQASTFQMAVLLQYNENTTWTVRQLEQHTGIKGDFLIQVLQILLKAKLLVCQDDESELTESSVIDLYLGYKNKKLRVNINIPLKTELKVEQEATHKHIEEDRKMLIQAAIVRIMKTRKTLKHQHLVVEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERTEGEKDTYSYLA 790          
BLAST of HiSeq36548 vs. genbank:protein
Match: gi|913306258|ref|XP_013183552.1| (PREDICTED: cullin-1 [Amyelois transitella] >gi|913306260|ref|XP_013183553.1| PREDICTED: cullin-1 [Amyelois transitella] >gi|913306262|ref|XP_013183554.1| PREDICTED: cullin-1 [Amyelois transitella])

HSP 1 Score: 734.947 bits (1896), Expect = 0.000e+0
Identity = 354/365 (96.99%), Postives = 361/365 (98.90%), Query Frame = 0
Query:    1 TKAANSSSKSPELLAKYCDLLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYSKMLAKRLVQHMSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNENFRKHMADSSEQPLHIDFSIQVLSSGSWPFQQSSSFQLPTELERSVHRFTAFYSAQHSGRKLNWLYNMSKGELVTNCFKNRYTLQASTFQMAVLLQYNENTAWTVRQLEHHTGIKGDFLLQVLQILLKAKLLVCQDDESELTESSVVELYVGYKNKKLRVNINIPLKTELKVEQEATHKHIEEDRKMLIQAAIVRIMKTRKTLKHQHLVVEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERTEGEKDTYSYLA 365
            TKAANSSSKSPELLAKYCDLLLKKSSKNPEE ELEDTLNQVMVVFKYIEDKDVFQKFYSKMLAKRLVQHMSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNENFRKHMA SSEQPLHIDFSIQVLSSGSWPFQQSSSFQLPTELERSVHRFT+FYS+QHSGRKLNWLYNMSKGELVTNCFKNRYTLQASTFQMAVLLQYN+N AW+VRQLEHHTGIKGDFLLQVLQILLKAKLLVCQDDE++LTESSVVELY+ YKNKKLRVNINIPLKTELKVEQEATHKHIEEDRKMLIQAAIVRIMKTRKTLKHQHLVVEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERTEGEKDTYSYLA
Sbjct:  425 TKAANSSSKSPELLAKYCDLLLKKSSKNPEEQELEDTLNQVMVVFKYIEDKDVFQKFYSKMLAKRLVQHMSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNENFRKHMAKSSEQPLHIDFSIQVLSSGSWPFQQSSSFQLPTELERSVHRFTSFYSSQHSGRKLNWLYNMSKGELVTNCFKNRYTLQASTFQMAVLLQYNDNAAWSVRQLEHHTGIKGDFLLQVLQILLKAKLLVCQDDEADLTESSVVELYLAYKNKKLRVNINIPLKTELKVEQEATHKHIEEDRKMLIQAAIVRIMKTRKTLKHQHLVVEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERTEGEKDTYSYLA 789          
BLAST of HiSeq36548 vs. genbank:protein
Match: gi|509180647|gb|JAA88444.1| (lin-19-like [Pararge aegeria])

HSP 1 Score: 734.561 bits (1895), Expect = 0.000e+0
Identity = 354/365 (96.99%), Postives = 362/365 (99.18%), Query Frame = 0
Query:    1 TKAANSSSKSPELLAKYCDLLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYSKMLAKRLVQHMSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNENFRKHMADSSEQPLHIDFSIQVLSSGSWPFQQSSSFQLPTELERSVHRFTAFYSAQHSGRKLNWLYNMSKGELVTNCFKNRYTLQASTFQMAVLLQYNENTAWTVRQLEHHTGIKGDFLLQVLQILLKAKLLVCQDDESELTESSVVELYVGYKNKKLRVNINIPLKTELKVEQEATHKHIEEDRKMLIQAAIVRIMKTRKTLKHQHLVVEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERTEGEKDTYSYLA 365
            TKAANSSSKSPELLAKYCDLLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYSKMLAKRLVQHMSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNENFRKHMA+SSEQPLHIDFSIQVLSSGSWPFQQSSSFQLPTELERSVHRFT FYS+QHSGRKLNWLYNMSKGELVTNCFKNRYTLQASTFQMAVLLQYN+NT+WTVRQLE HTGIKGDFL+QVLQILLKAKLLVC DDESELTESS+V+LY+GYKNKKLRVNINIPLKTELKVEQEATHKHIEEDRKMLIQAAIVRIMKTRKTLKHQHLVVEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERTEGEKDTYSYLA
Sbjct:  415 TKAANSSSKSPELLAKYCDLLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYSKMLAKRLVQHMSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNENFRKHMANSSEQPLHIDFSIQVLSSGSWPFQQSSSFQLPTELERSVHRFTTFYSSQHSGRKLNWLYNMSKGELVTNCFKNRYTLQASTFQMAVLLQYNDNTSWTVRQLEQHTGIKGDFLIQVLQILLKAKLLVCPDDESELTESSIVDLYLGYKNKKLRVNINIPLKTELKVEQEATHKHIEEDRKMLIQAAIVRIMKTRKTLKHQHLVVEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERTEGEKDTYSYLA 779          
BLAST of HiSeq36548 vs. genbank:protein
Match: gi|909563049|ref|XP_013136724.1| (PREDICTED: cullin-1 [Papilio polytes] >gi|909563051|ref|XP_013136725.1| PREDICTED: cullin-1 [Papilio polytes])

HSP 1 Score: 733.791 bits (1893), Expect = 0.000e+0
Identity = 352/365 (96.44%), Postives = 361/365 (98.90%), Query Frame = 0
Query:    1 TKAANSSSKSPELLAKYCDLLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYSKMLAKRLVQHMSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNENFRKHMADSSEQPLHIDFSIQVLSSGSWPFQQSSSFQLPTELERSVHRFTAFYSAQHSGRKLNWLYNMSKGELVTNCFKNRYTLQASTFQMAVLLQYNENTAWTVRQLEHHTGIKGDFLLQVLQILLKAKLLVCQDDESELTESSVVELYVGYKNKKLRVNINIPLKTELKVEQEATHKHIEEDRKMLIQAAIVRIMKTRKTLKHQHLVVEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERTEGEKDTYSYLA 365
            TKAANSSSKSPELLAKYCDLLLKKSSKNPE+AELEDTLNQVMVVFKYIEDKDVFQKFYSKMLAKRLVQHMSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNENFRKHMA++SEQPLHIDFSIQVLSSGSWPFQQSSSFQLPTELERSVHRFT FYS+QHSGRKLNWLYNMSKGELVTNCFKNRYTLQASTFQMAVLLQYN+NT WTVRQLE HTGIKGDFL+QVLQILLKAKLLVCQDDESELTESSV++LY+ YKNKKLRVNINIPLKTELKVEQEATHKHIEEDRKMLIQAAIVRIMKTRKTLKHQHLVVEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERTEGEKDTYSYLA
Sbjct:  426 TKAANSSSKSPELLAKYCDLLLKKSSKNPEDAELEDTLNQVMVVFKYIEDKDVFQKFYSKMLAKRLVQHMSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNENFRKHMANTSEQPLHIDFSIQVLSSGSWPFQQSSSFQLPTELERSVHRFTTFYSSQHSGRKLNWLYNMSKGELVTNCFKNRYTLQASTFQMAVLLQYNDNTTWTVRQLEQHTGIKGDFLIQVLQILLKAKLLVCQDDESELTESSVIDLYLAYKNKKLRVNINIPLKTELKVEQEATHKHIEEDRKMLIQAAIVRIMKTRKTLKHQHLVVEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERTEGEKDTYSYLA 790          
BLAST of HiSeq36548 vs. genbank:protein
Match: gi|512935502|ref|XP_004933289.1| (PREDICTED: cullin-1 [Bombyx mori] >gi|512935506|ref|XP_004933290.1| PREDICTED: cullin-1 [Bombyx mori])

HSP 1 Score: 728.013 bits (1878), Expect = 0.000e+0
Identity = 350/365 (95.89%), Postives = 361/365 (98.90%), Query Frame = 0
Query:    1 TKAANSSSKSPELLAKYCDLLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYSKMLAKRLVQHMSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNENFRKHMADSSEQPLHIDFSIQVLSSGSWPFQQSSSFQLPTELERSVHRFTAFYSAQHSGRKLNWLYNMSKGELVTNCFKNRYTLQASTFQMAVLLQYNENTAWTVRQLEHHTGIKGDFLLQVLQILLKAKLLVCQDDESELTESSVVELYVGYKNKKLRVNINIPLKTELKVEQEATHKHIEEDRKMLIQAAIVRIMKTRKTLKHQHLVVEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERTEGEKDTYSYLA 365
            TKAANSSSKSPELLAKYCDLLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYSKMLAKRLVQHMSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNENFRKHMA+SSEQPLHIDFSIQVLSSGSWPFQQS+SFQLPTELERSVHRFT FYS+QHSGRKLNWLYNMSKGEL+TNCFKNRYTLQASTFQMAVLLQYN+NT+WTVRQLE HTGIKGDFL+QVLQILLKAKLLVCQ+DE+EL E+SVV+LY GYKNKKLRVNINIPLKTELKVEQEATHKHIEEDRKMLIQAAIVRIMKTRKTLKHQHLVVEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERTEGEKDTYSYLA
Sbjct:  420 TKAANSSSKSPELLAKYCDLLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYSKMLAKRLVQHMSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNENFRKHMANSSEQPLHIDFSIQVLSSGSWPFQQSTSFQLPTELERSVHRFTTFYSSQHSGRKLNWLYNMSKGELLTNCFKNRYTLQASTFQMAVLLQYNDNTSWTVRQLEQHTGIKGDFLIQVLQILLKAKLLVCQEDEAELGENSVVDLYSGYKNKKLRVNINIPLKTELKVEQEATHKHIEEDRKMLIQAAIVRIMKTRKTLKHQHLVVEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERTEGEKDTYSYLA 784          
BLAST of HiSeq36548 vs. genbank:protein
Match: gi|806629179|gb|AKB96193.1| (cullin-1, partial [Cydia pomonella])

HSP 1 Score: 727.628 bits (1877), Expect = 0.000e+0
Identity = 352/365 (96.44%), Postives = 360/365 (98.63%), Query Frame = 0
Query:    1 TKAANSSSKSPELLAKYCDLLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYSKMLAKRLVQHMSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNENFRKHMADSSEQPLHIDFSIQVLSSGSWPFQQSSSFQLPTELERSVHRFTAFYSAQHSGRKLNWLYNMSKGELVTNCFKNRYTLQASTFQMAVLLQYNENTAWTVRQLEHHTGIKGDFLLQVLQILLKAKLLVCQDDESELTESSVVELYVGYKNKKLRVNINIPLKTELKVEQEATHKHIEEDRKMLIQAAIVRIMKTRKTLKHQHLVVEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERTEGEKDTYSYLA 365
            T+AANSSSKSPELLAKYCDLLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYSKMLAKRLVQHMSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNENFRKHM++SSE  LHIDFSIQVLSSGSWPFQQSSSFQLPTELERSV RFT FYS+QHSGRKLNWLYNMSKGELVTNCFKNRYTLQASTFQMAVLLQYNENTAW+VRQLE HTGIKGDFL+QVLQILLKAKLLVCQ+DESELTESS+VELYVGYKNKKLRVNINIPLKTELKVEQEATHKHIEEDRKMLIQAAIVRIMKTRKTLKHQHLVVEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERTEGEKDTYSYLA
Sbjct:  431 TRAANSSSKSPELLAKYCDLLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYSKMLAKRLVQHMSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNENFRKHMSNSSEPSLHIDFSIQVLSSGSWPFQQSSSFQLPTELERSVSRFTTFYSSQHSGRKLNWLYNMSKGELVTNCFKNRYTLQASTFQMAVLLQYNENTAWSVRQLEQHTGIKGDFLVQVLQILLKAKLLVCQEDESELTESSIVELYVGYKNKKLRVNINIPLKTELKVEQEATHKHIEEDRKMLIQAAIVRIMKTRKTLKHQHLVVEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERTEGEKDTYSYLA 795          
BLAST of HiSeq36548 vs. genbank:protein
Match: gi|1073529341|gb|JAT81782.1| (hypothetical protein g.10399 [Pectinophora gossypiella])

HSP 1 Score: 724.161 bits (1868), Expect = 0.000e+0
Identity = 349/365 (95.62%), Postives = 360/365 (98.63%), Query Frame = 0
Query:    1 TKAANSSSKSPELLAKYCDLLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYSKMLAKRLVQHMSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNENFRKHMADSSEQPLHIDFSIQVLSSGSWPFQQSSSFQLPTELERSVHRFTAFYSAQHSGRKLNWLYNMSKGELVTNCFKNRYTLQASTFQMAVLLQYNENTAWTVRQLEHHTGIKGDFLLQVLQILLKAKLLVCQDDESELTESSVVELYVGYKNKKLRVNINIPLKTELKVEQEATHKHIEEDRKMLIQAAIVRIMKTRKTLKHQHLVVEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERTEGEKDTYSYLA 365
            TKAANSSSKSPELLAKYCD+LLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYSKMLAKRLVQHMSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNENFRKHM++S EQPLHIDFSIQVLSSGSWPFQQSSSFQLPTELERSVHRFT FYS+QHSGRKLNWLYNMSKGELVTNCFKNRYTLQASTFQMAVLLQYNENT+W+VRQLE HTGIKGDFL+QVLQILLKAKLLVC +DE+ELTE+SVV+LYV YKNKKLRVNINIPLKTELKVEQEATHKHIEEDRKMLIQAAIVRIMKTRKTLKHQHLVVEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERTEGEKDTYSYLA
Sbjct:  418 TKAANSSSKSPELLAKYCDILLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYSKMLAKRLVQHMSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNENFRKHMSNSCEQPLHIDFSIQVLSSGSWPFQQSSSFQLPTELERSVHRFTTFYSSQHSGRKLNWLYNMSKGELVTNCFKNRYTLQASTFQMAVLLQYNENTSWSVRQLEQHTGIKGDFLIQVLQILLKAKLLVCAEDEAELTENSVVDLYVQYKNKKLRVNINIPLKTELKVEQEATHKHIEEDRKMLIQAAIVRIMKTRKTLKHQHLVVEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERTEGEKDTYSYLA 782          
BLAST of HiSeq36548 vs. genbank:protein
Match: gi|389615387|dbj|BAM20669.1| (cullin protein, partial [Papilio polytes])

HSP 1 Score: 694.886 bits (1792), Expect = 0.000e+0
Identity = 333/348 (95.69%), Postives = 344/348 (98.85%), Query Frame = 0
Query:    1 TKAANSSSKSPELLAKYCDLLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYSKMLAKRLVQHMSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNENFRKHMADSSEQPLHIDFSIQVLSSGSWPFQQSSSFQLPTELERSVHRFTAFYSAQHSGRKLNWLYNMSKGELVTNCFKNRYTLQASTFQMAVLLQYNENTAWTVRQLEHHTGIKGDFLLQVLQILLKAKLLVCQDDESELTESSVVELYVGYKNKKLRVNINIPLKTELKVEQEATHKHIEEDRKMLIQAAIVRIMKTRKTLKHQHLVVEVLNQLSSRFKPRVPVIKKCIDILIEK 348
            TKAANSSSKSPELLAKYCDLLLKKSSKNPE+AELEDTLNQVMVVFKYIEDKDVFQKFYSKMLAKRLVQHMSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNENFRKHMA++SEQPLHIDFSIQVLSSGSWPFQQSSSFQLPTELERSVHRFT FYS+QHSGRKLNWLYNMSKGELVTNCFKNRYTLQASTFQMAVLLQYN+NT WTVRQLE HTGIKGDFL+QVLQILLKAKLLVCQDDESELTESSV++LY+ YKNKKLRVNINIPLKTELKVEQEATHKHIEEDRKMLIQAAIVRIMKTRKTLKHQHLVVEVLNQLSSRFKPRVPVIKKCIDILI++
Sbjct:  299 TKAANSSSKSPELLAKYCDLLLKKSSKNPEDAELEDTLNQVMVVFKYIEDKDVFQKFYSKMLAKRLVQHMSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNENFRKHMANTSEQPLHIDFSIQVLSSGSWPFQQSSSFQLPTELERSVHRFTTFYSSQHSGRKLNWLYNMSKGELVTNCFKNRYTLQASTFQMAVLLQYNDNTTWTVRQLEQHTGIKGDFLIQVLQILLKAKLLVCQDDESELTESSVIDLYLAYKNKKLRVNINIPLKTELKVEQEATHKHIEEDRKMLIQAAIVRIMKTRKTLKHQHLVVEVLNQLSSRFKPRVPVIKKCIDILIDE 646          
BLAST of HiSeq36548 vs. genbank:protein
Match: gi|766923822|ref|XP_011506552.1| (PREDICTED: cullin-1 [Ceratosolen solmsi marchali])

HSP 1 Score: 657.136 bits (1694), Expect = 0.000e+0
Identity = 318/365 (87.12%), Postives = 340/365 (93.15%), Query Frame = 0
Query:    1 TKAANSSSKSPELLAKYCDLLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYSKMLAKRLVQHMSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNENFRKHMADSSEQPLHIDFSIQVLSSGSWPFQQSSSFQLPTELERSVHRFTAFYSAQHSGRKLNWLYNMSKGELVTNCFKNRYTLQASTFQMAVLLQYNENTAWTVRQLEHHTGIKGDFLLQVLQILLKAKLLVCQDDESELTESSVVELYVGYKNKKLRVNINIPLKTELKVEQEATHKHIEEDRKMLIQAAIVRIMKTRKTLKHQHLVVEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERTEGEKDTYSYLA 365
            TKAANSSSKSPELLAKYCD+LLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDV+QKFYSKMLAKRLVQHMSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNE+FR+H+ +S+E PL IDFSIQVLSSGSWPFQQS +F LPTELERSVHRFT FYS+QHSGRKLNWLYNMSKGEL TNCFKNRYTLQAST+QMAVLLQYN +T+WT++QL   T IK DFLLQV+QILLKAKLL+  DDESEL  SS +EL+ GYKNKKLRVNINIP+KTELK+EQE THKHIEEDRK+LIQAAIVRIMK RK LKHQ LV EVLNQLSSRFKPRV VIKKCIDILIEKEYLERTEG+KDTYSYLA
Sbjct:  410 TKAANSSSKSPELLAKYCDVLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVYQKFYSKMLAKRLVQHMSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEHFRRHLTNSAE-PLDIDFSIQVLSSGSWPFQQSFTFSLPTELERSVHRFTTFYSSQHSGRKLNWLYNMSKGELHTNCFKNRYTLQASTYQMAVLLQYNTSTSWTIQQLHESTQIKMDFLLQVIQILLKAKLLITNDDESELGSSSTIELFTGYKNKKLRVNINIPMKTELKIEQETTHKHIEEDRKLLIQAAIVRIMKMRKVLKHQQLVAEVLNQLSSRFKPRVHVIKKCIDILIEKEYLERTEGQKDTYSYLA 773          
The following BLAST results are available for this feature:
BLAST of HiSeq36548 vs. genbank:protein
Analysis Date: 2017-06-25 (Blastp: Transcriptome vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|910346156|ref|XP_013176974.1|0.000e+097.26PREDICTED: cullin-1 [Papilio xuthus] >gi|910346158... [more]
gi|943963491|ref|XP_014364051.1|0.000e+096.99PREDICTED: cullin-1 [Papilio machaon][more]
gi|913306258|ref|XP_013183552.1|0.000e+096.99PREDICTED: cullin-1 [Amyelois transitella] >gi|913... [more]
gi|509180647|gb|JAA88444.1|0.000e+096.99lin-19-like [Pararge aegeria][more]
gi|909563049|ref|XP_013136724.1|0.000e+096.44PREDICTED: cullin-1 [Papilio polytes] >gi|90956305... [more]
gi|512935502|ref|XP_004933289.1|0.000e+095.89PREDICTED: cullin-1 [Bombyx mori] >gi|512935506|re... [more]
gi|806629179|gb|AKB96193.1|0.000e+096.44cullin-1, partial [Cydia pomonella][more]
gi|1073529341|gb|JAT81782.1|0.000e+095.62hypothetical protein g.10399 [Pectinophora gossypi... [more]
gi|389615387|dbj|BAM20669.1|0.000e+095.69cullin protein, partial [Papilio polytes][more]
gi|766923822|ref|XP_011506552.1|0.000e+087.12PREDICTED: cullin-1 [Ceratosolen solmsi marchali][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006511 ubiquitin-dependent protein catabolic process
cellular_component GO:0031461 cullin-RING ubiquitin ligase complex
molecular_function GO:0031625 ubiquitin protein ligase binding
InterPro
Analysis Name: InterProScan: Transcriptome
Date Performed: 2017-06-25
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR016158Cullin homologySMARTSM00182CULLINcoord: 39..188
e-value: 2.2E-81
score: 286.4
IPR016158Cullin homologyPROSITEPS50069CULLIN_2coord: 9..238
score: 62.102
IPR016158Cullin homologySUPERFAMILY75632Cullin homology domaincoord: 5..274
IPR019559Cullin protein, neddylation domainSMARTSM00884Cullin_Nedd8coord: 292..359
e-value: 2.9E-37
score: 139.8
IPR019559Cullin protein, neddylation domainPFAMPF10557Cullin_Nedd8coord: 292..358
e-value: 2.3E-29
score: 100.8
NoneNo IPR availableGENE3D1.20.1310.10coord: 8..121
e-value: 5.2E-49
score: 164.9
NoneNo IPR availableGENE3D4.10.1030.10coord: 125..196
e-value: 2.0E-27
score: 94.1
NoneNo IPR availablePANTHERPTHR11932CULLINcoord: 1..365
NoneNo IPR availablePANTHERPTHR11932:SF19CULLIN-1coord: 1..365
NoneNo IPR availableSUPERFAMILY46785"Winged helix" DNA-binding domaincoord: 277..365
IPR001373Cullin, N-terminalPFAMPF00888Cullincoord: 7..260
e-value: 3.0E-94
score: 316.5
IPR011991Winged helix-turn-helix DNA-binding domainGENE3D1.10.10.10coord: 265..365
e-value: 4.5E-38
score: 129.1
IPR011991Winged helix-turn-helix DNA-binding domainGENE3D1.10.10.10coord: 198..264
e-value: 9.2E-23
score: 79.6
IPR016157Cullin, conserved sitePROSITEPS01256CULLIN_1coord: 338..365

Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Transcriptome2017-06-25
InterProScan: Transcriptome2017-06-25
Blastp: Transcriptome vs NR2017-06-25
Transcriptome denovo Assembly of Ostrinia scapulalis2017-06-23
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
HiSeq36548HiSeq36548Ostrinia scapulalismRNA?


Sequences
The following sequences are available for this feature:

polypeptide sequence

>HiSeq36548_p ID=HiSeq36548_p|Name=HiSeq36548|organism=Ostrinia scapulalis|type=polypeptide|length=365bp
TKAANSSSKSPELLAKYCDLLLKKSSKNPEEAELEDTLNQVMVVFKYIED
KDVFQKFYSKMLAKRLVQHMSASDDAEASMISKLKQACGFEYTSKLQRMF
QDIGVSKDLNENFRKHMADSSEQPLHIDFSIQVLSSGSWPFQQSSSFQLP
TELERSVHRFTAFYSAQHSGRKLNWLYNMSKGELVTNCFKNRYTLQASTF
QMAVLLQYNENTAWTVRQLEHHTGIKGDFLLQVLQILLKAKLLVCQDDES
ELTESSVVELYVGYKNKKLRVNINIPLKTELKVEQEATHKHIEEDRKMLI
QAAIVRIMKTRKTLKHQHLVVEVLNQLSSRFKPRVPVIKKCIDILIEKEY
LERTEGEKDTYSYLA
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0031625ubiquitin protein ligase binding
Vocabulary: Biological Process
TermDefinition
GO:0006511ubiquitin-dependent protein catabolic process
Vocabulary: Cellular Component
TermDefinition
GO:0031461cullin-RING ubiquitin ligase complex
Vocabulary: INTERPRO
TermDefinition
IPR016157Cullin_CS
IPR011991WHTH_DNA-bd_dom
IPR001373Cullin_N
IPR019559Cullin_neddylation_domain
IPR016158Cullin_homology