OSCA012500-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA012500-RA
Unique NameOSCA012500-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length662
Homology
BLAST of OSCA012500-RA vs. genbank:protein
Match: gi|930649331|gb|KPI91679.1| (Intraflagellar transport protein osm-1 [Papilio xuthus])

HSP 1 Score: 867.84 bits (2241), Expect = 0.000e+0
Identity = 443/657 (67.43%), Postives = 514/657 (78.23%), Query Frame = 0
Query:    9 NGQIPWAGGGERVYAAVGGACLLHRAGELSVVEYGLDRVLHTVRTERVNPHVLSVRINEGGDT---RKHLAYLLDRQTIAVVDLTTVVKFFGAIDLVEFNSKIGVQLGQWWXEARVDWLELNETGQLLLLRDTRRRLALLRLETGDKEIIASGVGFVQWIENCDAVVAQTPTHLLIWYSVWEADSAEMAECSGGVAVEVNARRVLFEGGQVPYLQLDEHRLAFNNALRSGDLAGCAKYLDGVGNNADVSSLWRQLAERALATDDIQLAAKCYREVGDEARMFYLDKTVELAASVGDGDVTTGLNVATVRARLSIFAGDLPSAEEWYVKKAGKPELAIDMYKQFNRWAEAVALAEKTDRAAVAMLKQQHMDYLTSTGRLGEAGAALASSGDVQGAVRLWLRGGRARRAAALLLQHASLLXGAAMAARRARAQSRCAVAATCFAAAGYGTGGCCTYATCAEWWEMAGEISERRGDSRTAVEYYAKGNNFARAVQLAREACPAEVTSLEGMWGSWLVSSRQAGAAVPHLIEAGDTRGALAAALKAHHYRKALQIVQVIEDKESIREQCEQLGDHFISTQEWETAERVLSSCGMAERGVRAYNTAGRVADGLRLAAQHLTEEETRDIYLPLAQQMREDGQLRKAEQIYIGLGEPDEAISMY 662
              +I W+G GER+YAAVGGACLLHRAGELSVVEYGLD+VLHTVRTERVNPHVLSVR+NEG      RKHLAYLLD+QT+AV+DL +                 GVQ+GQWW EARVDWLELNE+ +LLL RDTRR L LLRL+T +KE IA GV FVQWIEN DAVVAQT THLLIWYS WE  S E  EC GG+AVEV+ARRVL EGGQ+PY+QLDEHRLAFN+AL +GDL  CAKYL+GVG +ADV++LWRQLA+ AL   DIQLAAKCYRE GDEAR  +LD  ++LAA+ GDGDV  GL+   V+A L I AG+L  A E YV++AG+P LA+DMY+++N W+EA+ALAEK   A    +K+Q+MDYL STGR+GEAG  LA+ G+V+GAVRLWLRGGR RRAA  LL HASLL    +                             T     EWWE+AGE+SE+RGDS+ AVEYYA+G+N+ARAVQLARE+CP +VT LEG WG+WL  +RQ+GAAVPHLIEAGDTR AL AALKAH Y+KALQIVQVI+DKESIREQCEQLGDHFISTQ+WETAE VL+S  MAER V+AYNTAGR+ADGLR+AA HLTEE+TRDIYLPLAQQ+RE+GQLRKAEQIYI LGEPDEAISMY
Sbjct:  374 TSEIAWSGSGERIYAAVGGACLLHRAGELSVVEYGLDKVLHTVRTERVNPHVLSVRVNEGPTQAADRKHLAYLLDKQTVAVLDLVS-----------------GVQVGQWWHEARVDWLELNESARLLLYRDTRRNLTLLRLDTAEKETIARGVSFVQWIENSDAVVAQTHTHLLIWYSAWEPGSVETVECEGGIAVEVSARRVLLEGGQLPYVQLDEHRLAFNSALDNGDLTTCAKYLEGVGGSADVTALWRQLADTALNAHDIQLAAKCYREAGDEARSLFLDNALQLAATEGDGDVAIGLSSPVVQAELCILAGNLSEAAECYVRRAGQPRLALDMYRRYNVWSEAIALAEKHFPAEAPDMKRQYMDYLMSTGRVGEAGEVLAAGGEVRGAVRLWLRGGRVRRAATALLAHASLLRDDEL------------------------VHAVHTQLVQEEWWELAGEMSEKRGDSKAAVEYYARGHNYARAVQLARESCPEQVTVLEGAWGAWLAGARQSGAAVPHLIEAGDTRAALHAALKAHLYKKALQIVQVIDDKESIREQCEQLGDHFISTQDWETAENVLTSSNMAERCVKAYNTAGRIADGLRVAATHLTEEQTRDIYLPLAQQLREEGQLRKAEQIYIALGEPDEAISMY 989          
BLAST of OSCA012500-RA vs. genbank:protein
Match: gi|943953236|ref|XP_014359502.1| (PREDICTED: intraflagellar transport protein 172 homolog [Papilio machaon])

HSP 1 Score: 866.3 bits (2237), Expect = 0.000e+0
Identity = 444/657 (67.58%), Postives = 511/657 (77.78%), Query Frame = 0
Query:    9 NGQIPWAGGGERVYAAVGGACLLHRAGELSVVEYGLDRVLHTVRTERVNPHVLSVRINEGGDT---RKHLAYLLDRQTIAVVDLTTVVKFFGAIDLVEFNSKIGVQLGQWWXEARVDWLELNETGQLLLLRDTRRRLALLRLETGDKEIIASGVGFVQWIENCDAVVAQTPTHLLIWYSVWEADSAEMAECSGGVAVEVNARRVLFEGGQVPYLQLDEHRLAFNNALRSGDLAGCAKYLDGVGNNADVSSLWRQLAERALATDDIQLAAKCYREVGDEARMFYLDKTVELAASVGDGDVTTGLNVATVRARLSIFAGDLPSAEEWYVKKAGKPELAIDMYKQFNRWAEAVALAEKTDRAAVAMLKQQHMDYLTSTGRLGEAGAALASSGDVQGAVRLWLRGGRARRAAALLLQHASLLXGAAMAARRARAQSRCAVAATCFAAAGYGTGGCCTYATCAEWWEMAGEISERRGDSRTAVEYYAKGNNFARAVQLAREACPAEVTSLEGMWGSWLVSSRQAGAAVPHLIEAGDTRGALAAALKAHHYRKALQIVQVIEDKESIREQCEQLGDHFISTQEWETAERVLSSCGMAERGVRAYNTAGRVADGLRLAAQHLTEEETRDIYLPLAQQMREDGQLRKAEQIYIGLGEPDEAISMY 662
              +IPW G GER+YAAVGGACLLHRAGELSVVEYGLD+VLHTVRTERVNPHVLSVR+NEG      RKHLAYLLD+QT+AV+DL T                 GVQ+GQWW EARVDWLELNE+ +LLL RDTRR L LLRL+T +KE IA GV FVQWIEN DAVVAQT THLLIWYS WE  S E  EC GG+AVEV+ARRVL EGGQ+PY+QLDEHRLAFN+AL  GDL  CAKYL+GVG +ADV++LWRQLA+ AL   DIQLA KCYRE GDEAR  +LD  ++LAA+ GDGDV TGL+   V+A L I AG+L  A E YVK+AG+P LA+DMY+++N W EA+ALAEK   A  + +K+Q+MDYL STGR GEAG  LA+ G+V+GAVRLWLRGGR RRAA  LL HASLL    +                             T+    EWWE+AGE+SE+RGDS+ AVEYYA+G+N+ARAVQLARE+CP +VT LE  WG+WL  +RQAGAAVPHLIEAGDTR AL AALKAH Y+KALQIVQVI+DKESIR QCEQLGDHFISTQ+WETAE VL+S  MAER V+AYNTAGR+ADGLR+AA HLTEE+TR+IYLPLAQQ+RE+GQLRKAEQIYI LGEPDEAISMY
Sbjct:  374 TSEIPWNGSGERIYAAVGGACLLHRAGELSVVEYGLDKVLHTVRTERVNPHVLSVRVNEGPTQSADRKHLAYLLDKQTVAVLDLVT-----------------GVQVGQWWHEARVDWLELNESARLLLYRDTRRNLTLLRLDTAEKETIARGVSFVQWIENSDAVVAQTHTHLLIWYSAWEPGSVETVECEGGIAVEVSARRVLLEGGQLPYVQLDEHRLAFNSALDGGDLTTCAKYLEGVGGSADVTALWRQLADTALNAHDIQLATKCYREAGDEARSLFLDNALQLAATEGDGDVATGLSSPVVQAELCILAGNLSEAAECYVKRAGRPRLALDMYRRYNVWPEAIALAEKHFPAEASDMKRQYMDYLMSTGRAGEAGEVLAADGEVRGAVRLWLRGGRVRRAATALLAHASLLRDDEL------------------------VHVVHTHLVQEEWWELAGELSEKRGDSKAAVEYYARGHNYARAVQLARESCPEQVTELERAWGAWLSGARQAGAAVPHLIEAGDTRAALHAALKAHLYKKALQIVQVIDDKESIRVQCEQLGDHFISTQDWETAESVLTSSNMAERCVKAYNTAGRIADGLRVAASHLTEEQTRNIYLPLAQQLREEGQLRKAEQIYIALGEPDEAISMY 989          
BLAST of OSCA012500-RA vs. genbank:protein
Match: gi|910337939|ref|XP_013172557.1| (PREDICTED: intraflagellar transport protein osm-1 [Papilio xuthus])

HSP 1 Score: 866.3 bits (2237), Expect = 0.000e+0
Identity = 443/657 (67.43%), Postives = 513/657 (78.08%), Query Frame = 0
Query:    9 NGQIPWAGGGERVYAAVGGACLLHRAGELSVVEYGLDRVLHTVRTERVNPHVLSVRINEGGDT---RKHLAYLLDRQTIAVVDLTTVVKFFGAIDLVEFNSKIGVQLGQWWXEARVDWLELNETGQLLLLRDTRRRLALLRLETGDKEIIASGVGFVQWIENCDAVVAQTPTHLLIWYSVWEADSAEMAECSGGVAVEVNARRVLFEGGQVPYLQLDEHRLAFNNALRSGDLAGCAKYLDGVGNNADVSSLWRQLAERALATDDIQLAAKCYREVGDEARMFYLDKTVELAASVGDGDVTTGLNVATVRARLSIFAGDLPSAEEWYVKKAGKPELAIDMYKQFNRWAEAVALAEKTDRAAVAMLKQQHMDYLTSTGRLGEAGAALASSGDVQGAVRLWLRGGRARRAAALLLQHASLLXGAAMAARRARAQSRCAVAATCFAAAGYGTGGCCTYATCAEWWEMAGEISERRGDSRTAVEYYAKGNNFARAVQLAREACPAEVTSLEGMWGSWLVSSRQAGAAVPHLIEAGDTRGALAAALKAHHYRKALQIVQVIEDKESIREQCEQLGDHFISTQEWETAERVLSSCGMAERGVRAYNTAGRVADGLRLAAQHLTEEETRDIYLPLAQQMREDGQLRKAEQIYIGLGEPDEAISMY 662
              +I W+G GER+YAAVGGACLLHRAGELSVVEYGLD+VLHTVRTERVNPHVLSVR+NEG      RKHLAYLLD+QT+AV+DL +                 GVQ+GQWW EARVDWLELNE+ +LLL RDTRR L LLRL+T +KE IA GV FVQWIEN DAVVAQT THLLIWYS WE  S E  EC GG+AVEV+ARRVL EGGQ+PY+QLDEHRLAFN+AL +GDL  CAKYL+GVG +ADV++LWRQLA+ AL   DIQLAAKCYRE GDEAR  +LD  ++LAA+ GDGDV  GL+   V+A L I AG+L  A E YV++AG+P LA+DMY+++N W+EA+ALAEK   A    +K+Q+MDYL STGR+GEAG  LA+ G+V+GAVRLWLRGGR RRAA  LL HASLL    +                             T     EWWE+AGE+SE+RGDS+ AVEYYA+G+N+ARAVQLARE+CP +VT LEG WG+WL  +RQAGAAVPHLIEAGDTR AL AALKAH Y+KALQIVQVI+DKESIREQCEQLGDHFISTQ+WETAE VL+S  MAER V+AYNTA R+ADGLR+AA HLTEE+TRDIYLPLAQQ+RE+GQLRKAEQIYI LGEPDEAISMY
Sbjct:  374 TSEIAWSGSGERIYAAVGGACLLHRAGELSVVEYGLDKVLHTVRTERVNPHVLSVRVNEGPTQAADRKHLAYLLDKQTVAVLDLVS-----------------GVQVGQWWHEARVDWLELNESARLLLYRDTRRNLTLLRLDTAEKETIARGVSFVQWIENSDAVVAQTHTHLLIWYSAWEPGSVETVECEGGIAVEVSARRVLLEGGQLPYVQLDEHRLAFNSALDNGDLTTCAKYLEGVGGSADVTALWRQLADTALNAHDIQLAAKCYREAGDEARSLFLDNALQLAATEGDGDVAIGLSSPVVQAELCILAGNLSEAAECYVRRAGQPRLALDMYRRYNVWSEAIALAEKHFPAEAPDMKRQYMDYLMSTGRVGEAGEVLAAGGEVRGAVRLWLRGGRVRRAATALLAHASLLRDDEL------------------------VHAVHTQLVQEEWWELAGEMSEKRGDSKAAVEYYARGHNYARAVQLARESCPEQVTVLEGAWGAWLAGARQAGAAVPHLIEAGDTRAALHAALKAHLYKKALQIVQVIDDKESIREQCEQLGDHFISTQDWETAENVLTSSNMAERCVKAYNTASRIADGLRVAATHLTEEQTRDIYLPLAQQLREEGQLRKAEQIYIALGEPDEAISMY 989          
BLAST of OSCA012500-RA vs. genbank:protein
Match: gi|930673866|gb|KPJ14298.1| (Intraflagellar transport protein osm-1 [Papilio machaon])

HSP 1 Score: 858.981 bits (2218), Expect = 0.000e+0
Identity = 446/666 (66.97%), Postives = 512/666 (76.88%), Query Frame = 0
Query:    9 NGQIPWAGGGERVYAAVGGACLLHRAGELSVVEYGLDRVLHTVRTERVNPHVLSVRINEGGDT---RKHLAYLLDRQTIAVVDLTTVVKFFGAIDLVEFNSKIGVQLGQWWXEARVDWLELNETGQLLLLRDTRRRLALLRLETGDKEIIASGVGFVQWIENCDAVVAQTPTHLLIWYSVWEADSAEMAECSGGVAVEVNARRVLFEGGQVPYLQLDEHRLAFNNALRSGDLAGCAKYLDGVGNNADVSSLWRQLAERALATDDIQLAAKCYREVGDEARMFYLDKTVELAASVGDGDVTTGLNVATVRARLSIFAGDLPSAEEWYVKKAGKPELAIDMYKQFNRWAEAVALAEKTDRAAVAMLKQQHMDYLTSTG---------RLGEAGAALASSGDVQGAVRLWLRGGRARRAAALLLQHASLLXGAAMAARRARAQSRCAVAATCFAAAGYGTGGCCTYATCAEWWEMAGEISERRGDSRTAVEYYAKGNNFARAVQLAREACPAEVTSLEGMWGSWLVSSRQAGAAVPHLIEAGDTRGALAAALKAHHYRKALQIVQVIEDKESIREQCEQLGDHFISTQEWETAERVLSSCGMAERGVRAYNTAGRVADGLRLAAQHLTEEETRDIYLPLAQQMREDGQLRKAEQIYIGLGEPDEAISMY 662
              +IPW G GER+YAAVGGACLLHRAGELSVVEYGLD+VLHTVRTERVNPHVLSVR+NEG      RKHLAYLLD+QT+AV+DL T                 GVQ+GQWW EARVDWLELNE+ +LLL RDTRR L LLRL+T +KE IA GV FVQWIEN DAVVAQT THLLIWYS WE  S E  EC GG+AVEV+ARRVL EGGQ+PY+QLDEHRLAFN+AL  GDL  CAKYL+GVG +ADV++LWRQLA+ AL   DIQLA KCYRE GDEAR  +LD  ++LAA+ GDGDV TGL+   V+A L I AG+L  A E YVK+AG+P LA+DMY+++N W EA+ALAEK   A  + +K+Q+MDYL STG         R GEAG  LA+ G+V+GAVRLWLRGGR RRAA  LL HASLL          R      V  T              +    EWWE+AGE+SE+RGDS+ AVEYYA+G+N+ARAVQLARE+CP +VT LE  WG+WL  +RQAGAAVPHLIEAGDTR AL AALKAH Y+KALQIVQVI+DKESIR QCEQLGDHFISTQ+WETAE VL+S  MAER V+AYNTAGR+ADGLR+AA HLTEE+TR+IYLPLAQQ+RE+GQLRKAEQIYI LGEPDEAISMY
Sbjct:  374 TSEIPWNGSGERIYAAVGGACLLHRAGELSVVEYGLDKVLHTVRTERVNPHVLSVRVNEGPTQSADRKHLAYLLDKQTVAVLDLVT-----------------GVQVGQWWHEARVDWLELNESARLLLYRDTRRNLTLLRLDTAEKETIARGVSFVQWIENSDAVVAQTHTHLLIWYSAWEPGSVETVECEGGIAVEVSARRVLLEGGQLPYVQLDEHRLAFNSALDGGDLTTCAKYLEGVGGSADVTALWRQLADTALNAHDIQLATKCYREAGDEARSLFLDNALQLAATEGDGDVATGLSSPVVQAELCILAGNLSEAAECYVKRAGRPRLALDMYRRYNVWPEAIALAEKHFPAEASDMKRQYMDYLMSTGGPEVLQCVGRAGEAGEVLAADGEVRGAVRLWLRGGRVRRAATALLAHASLL----------RDDELVHVVHT--------------HLVQEEWWELAGELSEKRGDSKAAVEYYARGHNYARAVQLARESCPEQVTELERAWGAWLSGARQAGAAVPHLIEAGDTRAALHAALKAHLYKKALQIVQVIDDKESIRVQCEQLGDHFISTQDWETAESVLTSSNMAERCVKAYNTAGRIADGLRVAASHLTEEQTRNIYLPLAQQLREEGQLRKAEQIYIALGEPDEAISMY 998          
BLAST of OSCA012500-RA vs. genbank:protein
Match: gi|909569154|ref|XP_013140063.1| (PREDICTED: intraflagellar transport protein osm-1, partial [Papilio polytes])

HSP 1 Score: 838.951 bits (2166), Expect = 0.000e+0
Identity = 443/657 (67.43%), Postives = 509/657 (77.47%), Query Frame = 0
Query:    9 NGQIPWAGGGERVYAAVGGACLLHRAGELSVVEYGLDRVLHTVRTERVNPHVLSVRINEGGDT---RKHLAYLLDRQTIAVVDLTTVVKFFGAIDLVEFNSKIGVQLGQWWXEARVDWLELNETGQLLLLRDTRRRLALLRLETGDKEIIASGVGFVQWIENCDAVVAQTPTHLLIWYSVWEADSAEMAECSGGVAVEVNARRVLFEGGQVPYLQLDEHRLAFNNALRSGDLAGCAKYLDGVGNNADVSSLWRQLAERALATDDIQLAAKCYREVGDEARMFYLDKTVELAASVGDGDVTTGLNVATVRARLSIFAGDLPSAEEWYVKKAGKPELAIDMYKQFNRWAEAVALAEKTDRAAVAMLKQQHMDYLTSTGRLGEAGAALASSGDVQGAVRLWLRGGRARRAAALLLQHASLLXGAAMAARRARAQSRCAVAATCFAAAGYGTGGCCTYATCAEWWEMAGEISERRGDSRTAVEYYAKGNNFARAVQLAREACPAEVTSLEGMWGSWLVSSRQAGAAVPHLIEAGDTRGALAAALKAHHYRKALQIVQVIEDKESIREQCEQLGDHFISTQEWETAERVLSSCGMAERGVRAYNTAGRVADGLRLAAQHLTEEETRDIYLPLAQQMREDGQLRKAEQIYIGLGEPDEAISMY 662
              +IPW+G GER+YAAVGGACLLHRAGELSVVEYGLD+VLHTVRTERVNPHVLSVR+NEG      RKHLAYLLD+QT+AV+DL T                 GVQ+GQWW EARVDWLELNE+ +LLL RDTRR L LLRL+T DKE IA GV FVQWIEN DAVVAQT THLLIWYS WE  S E  EC GGVAVEV+ARRV+ EGGQ+PY+QLDEHRLAFN+AL  GDL  CAKYL+GVG +ADV++LW+QLA+ AL  +DIQLAA CYRE GDEAR  +LD  ++LAA  GDGDV  GL    V+A L I AG +  A E YV++AG+P LA+DMY+++N W EA+ALAEK   A    LK+Q+MDYL STGR GEAG  LA+ G+V+GAVRLWLRGGR RRAAA LL H SLL    +                             T+    EWWE+AGE+SE+RGD++ AVEY+AKG+N+ARAVQLARE CP +VT+LE  WG+WL  +RQAGAAVPHLIEAGDTR AL AALKAH Y+KALQIVQVI+DKESIREQCEQLGDHFISTQ+WETAE VL+S  MAER V+AYNTAGR+ADGLR+AA HLTEE+TRDIYLPLAQQ+RE+GQLRKAEQIYIGLGEPDEAIS Y
Sbjct:  374 TSEIPWSGSGERIYAAVGGACLLHRAGELSVVEYGLDKVLHTVRTERVNPHVLSVRVNEGPTQAADRKHLAYLLDKQTVAVLDLVT-----------------GVQVGQWWHEARVDWLELNESARLLLYRDTRRNLTLLRLDTADKETIARGVSFVQWIENSDAVVAQTHTHLLIWYSAWEPGSVESVECEGGVAVEVSARRVVLEGGQLPYVQLDEHRLAFNSALEGGDLTTCAKYLEGVGGSADVTALWKQLADTALEANDIQLAATCYREAGDEARSLFLDNALQLAAVEGDGDVAAGLCSPVVQAELCILAGRVSEAAECYVRRAGRPRLALDMYRRYNIWPEAIALAEKHFPAEAPELKRQYMDYLMSTGRAGEAGEVLAAGGEVRGAVRLWLRGGRVRRAAAALLAHTSLLRDDEL------------------------LHAVHTHLVQEEWWELAGELSEKRGDTKAAVEYFAKGHNYARAVQLAREWCPEQVTALERAWGAWLAGARQAGAAVPHLIEAGDTRAALHAALKAHLYKKALQIVQVIDDKESIREQCEQLGDHFISTQDWETAENVLTSSNMAERCVKAYNTAGRIADGLRVAASHLTEEQTRDIYLPLAQQLREEGQLRKAEQIYIGLGEPDEAISTY 989          
BLAST of OSCA012500-RA vs. genbank:protein
Match: gi|913318896|ref|XP_013190499.1| (PREDICTED: intraflagellar transport protein osm-1 [Amyelois transitella])

HSP 1 Score: 806.979 bits (2083), Expect = 0.000e+0
Identity = 438/624 (70.19%), Postives = 489/624 (78.37%), Query Frame = 0
Query:   11 QIPWAGGGERVYAAVGGACLLHRAGELSVVEYGLDRVLHTVRTERVNPHVLSVRINEGGDT-----RKHLAYLLDRQTIAVVDLTTVVKFFGAIDLVEFNSKIGVQLGQWWXEARVDWLELNETGQLLLLRDTRRRLALLRLETGDKEIIASGVGFVQWIENCDAVVAQTPTHLLIWYSVWEADSAEMAECSGGVAVEVNARRVLFEGGQVPYLQLDEHRLAFNNALRSGDLAGCAKYLDGVGNNADVSSLWRQLAERALATDDIQLAAKCYREVGDEARMFYLDKTVELAASVGDGDVTTGLNVATVRARLSIFAGDLPSAEEWYVKKAGKPELAIDMYKQFNRWAEAVALAEKTDRAAVAMLKQQHMDYLTSTGRLGEAGAALASSGDVQGAVRLW--------------LRGGRARRAAALLLQHASLLXGAAMAARRARAQSRCAVAATCFAAAGYGTGGCCTYATCAEWWEMAGEISERRGDSRTAVEYYAKGNNFARAVQLAREACPAEVTSLEGMWGSWLVSSRQAGAAVPHLIEAGDTRGALAAALKAHHYRKALQIVQVIEDKESIREQCEQLGDHFISTQEWETAERVLSSCGMAERGVRAYNTAGRVADGLRL 615
             IPW+GGGERVYAAVGGACLL+RAGELSV+EYGLD+VLHTVRTERVNPHVLSVRINEG  +     RKHLAYLLDRQT+AVVDL T                 G+QLGQWW EAR+DWLELNE+ +LLLLRDTRRRLALL+L++G+KEIIASGVGFVQWIEN DAVVAQTPTHLLIWYS WE  S EMAECSGGVA+EV+ARRV+F+GGQ+P   LDEHRLAFNNALRSGDL GCA YLDGVG++ADV+ LWRQLA+RALA DDIQLAAKCYREVGDEAR FYLDKTVE+A   G GDV  GL    VRARLSIF+GDLPSAEEWYVK+A +P+LAI MY+QFNRWAEA+ALAE+ DR +VA LKQQHMDYLTSTGRLGEAGAALAS+GDV+GAVRLW               +    R    L   HA L+       RR + +                           EWWEMAGEISE+RGD+RTA+EYYAKGNNFARAVQLAREA P+EVT LEG WG+WLVS+RQAGAAVPHLIEAGDTR AL AALKAHHY+KALQIVQVIEDKESI+EQCEQLGDHFI+TQEWETAE+VLSSC + E G  A  +AG V   +RL
Sbjct:  347 NIPWSGGGERVYAAVGGACLLYRAGELSVLEYGLDKVLHTVRTERVNPHVLSVRINEGVSSTDRNDRKHLAYLLDRQTVAVVDLVT-----------------GIQLGQWWHEARIDWLELNESSELLLLRDTRRRLALLKLQSGEKEIIASGVGFVQWIENSDAVVAQTPTHLLIWYSAWEPGSVEMAECSGGVALEVSARRVVFDGGQLP---LDEHRLAFNNALRSGDLVGCATYLDGVGSHADVAPLWRQLADRALANDDIQLAAKCYREVGDEARTFYLDKTVEIATDEGHGDVVAGLKSPLVRARLSIFSGDLPSAEEWYVKRASRPDLAIAMYRQFNRWAEAIALAERVDRPSVASLKQQHMDYLTSTGRLGEAGAALASAGDVRGAVRLWLRGGRARRAAALLLQQPALLREDDLLDAVHAQLIQ-VVYEGRRVKPE---------------------------EWWEMAGEISEKRGDTRTAIEYYAKGNNFARAVQLAREAWPSEVTRLEGAWGAWLVSARQAGAAVPHLIEAGDTRAALTAALKAHHYKKALQIVQVIEDKESIKEQCEQLGDHFIATQEWETAEKVLSSCRLGEAGA-ALASAGDVRGAVRL 921          

HSP 2 Score: 377.096 bits (967), Expect = 1.297e-110
Identity = 208/311 (66.88%), Postives = 233/311 (74.92%), Query Frame = 0
Query:  366 VAMLKQQHMDYLTSTGRLGEAGAALASSGDVQGAVRLWLRGGRA--------------RRAAALLLQHASLLXGAAMAARRARAQSRCAVAATCFAAAGYGTGGCCTYATCAEWWEMAGEISERRGDSRTAVEYYAKGNNFARAVQLAREACPAEVTSLEGMWGSWLVSSRQAGAAVPHLIEAGDTRGALAAALKAHHYRKALQIVQVIEDKESIREQCEQLGDHFISTQEWETAERVLSSCGMAERGVRAYNTAGRVADGLRLAAQHLTEEETRDIYLPLAQQMREDGQLRKAEQIYIGLGEPDEAISMY 662
            +A  + +  + + S+ RLGEAGAALAS+GDV+GAVRLWLRGGRA              R    L   HA L+       RR + +                           EWWEMAGEISE+RGD+RTA+EYYAKGNNFARAVQLAREA P+EVT LEG WG+WLVS+RQAGAAVPHLIEAGDTR AL AALKAHHY+KALQIVQVIEDKESI+EQCEQLGDHFI+TQEWETAE+VLSSCG+AER VRAYN AGR ADGLRLAA  LTE+ETRDIYLPLA+Q+R DGQ RKAEQIYIGLGEPDEAISMY
Sbjct:  885 IATQEWETAEKVLSSCRLGEAGAALASAGDVRGAVRLWLRGGRARRAAALLLQQPALLREDDLLDAVHAQLIQ-VVYEGRRVKPE---------------------------EWWEMAGEISEKRGDTRTAIEYYAKGNNFARAVQLAREAWPSEVTRLEGAWGAWLVSARQAGAAVPHLIEAGDTRAALTAALKAHHYKKALQIVQVIEDKESIKEQCEQLGDHFIATQEWETAEKVLSSCGLAERCVRAYNEAGRSADGLRLAAAALTEQETRDIYLPLAEQLRSDGQFRKAEQIYIGLGEPDEAISMY 1167          
BLAST of OSCA012500-RA vs. genbank:protein
Match: gi|768430379|ref|XP_011556414.1| (PREDICTED: intraflagellar transport protein osm-1-like [Plutella xylostella])

HSP 1 Score: 702.205 bits (1811), Expect = 0.000e+0
Identity = 394/586 (67.24%), Postives = 445/586 (75.94%), Query Frame = 0
Query:  109 GVQLGQWWXEARVDWLELNETGQLLLLRDTRRRLALLRLETGDK-EIIASGVGFVQWIENCDAVVAQTPTHLLIWYSVWEADSAEMAECSGGVAVEVNARRVLFEGGQVPYLQLDEHRLAFNNALRSGDLAGCAKYLDGVGNNADVSSLWRQLAERALATDDIQLAAKCYREVGDEARMFYLDKTVELAASVGDGDVTTGLNVATVRARLSIFAGDLPSAEEWYVKKAGKPELAIDMYKQFNRWAEAVALAEKTDRAAVAMLKQQHMDYLTSTGRLGEAGAALASSGDVQGAVRLWLRGGRARRAAALLLQHASLLXGAAMAARRARAQSRCAVAATCFAAAGYGTGGCCTYATCAEWWEMAGEISERRGDSRTAVEYYAKGNNFARAVQLAREACPAEVTSLEGMWGSWLVSSRQ-----------AGAAVPH-----------------LIE---AGDTRGALAAALKAHHYRKALQIVQVIEDKESIREQCEQLGDHFISTQEWETAERVLSSCGMAERGVRAYNTAGRVADGLRLAAQHLTEEETRDIYLPLAQQMREDGQLRKAEQIYIGLGEPDEAISMY 662
            G+Q GQWW E R+DWL LNE+GQLLL+RDTRRRL LL L TGDK EIIAS VGFVQWIE  DAVVAQTPTHLLIWYS W+  S EMAE  GG AVEV ARRV+ EGG VPYLQLD+HRL FNNAL SGDLAGCA+YLDGVGNNAD++ LWRQLAERA A +D+QLAAKCYREVGD+AR FYLDKTVELA++ G GDV+ GL+   V+ARL+IF  DL SAEE Y KKAG+PELAI MYKQFNRW EA+A+AEKTDR+ VA LKQQHMDYL STGRLGEAGAA+ S+GD QGAVRLWLRGGRARRAAALLL +  LL    +                             +     EWWEMAGE++E+RGD+  AVEYYAKG+N+ARAVQLAREACP EVT LEG WG  LVS RQ              A PH                 L E   AG TR AL+AAL+AHHY+KA Q VQVI+DKESIRE+CE+LGDHFIS QEWETAE+VLS CGMA+R VRAYN AG+ A+GLRLAA+HL+EEETRDIY+PLA+++R+DGQ RKAEQIYIGLGE DEAISMY
Sbjct:   11 GIQGGQWWNEDRIDWLGLNESGQLLLMRDTRRRLGLLHLRTGDKGEIIASAVGFVQWIEQSDAVVAQTPTHLLIWYSAWDPGSVEMAESGGGTAVEVVARRVVLEGGPVPYLQLDDHRLEFNNALASGDLAGCARYLDGVGNNADIAPLWRQLAERAFANEDVQLAAKCYREVGDDARTFYLDKTVELASTEGHGDVSEGLHSPLVQARLAIFTSDLASAEECYTKKAGQPELAIQMYKQFNRWTEAIAVAEKTDRSVVAELKQQHMDYLISTGRLGEAGAAMVSAGDSQGAVRLWLRGGRARRAAALLLHNPVLLRDNEI------------------------VDAVHSQLIQEEWWEMAGELAEKRGDNLAAVEYYAKGHNYARAVQLAREACPGEVTRLEGSWGEHLVSQRQGAAAAPPPLTAGATAAPHRGGPHARRALRRAPGAPLQEGDAAGRTRTALSAALRAHHYKKATQCVQVIDDKESIREECEELGDHFISIQEWETAEKVLSECGMADRCVRAYNAAGKYAEGLRLAARHLSEEETRDIYMPLAEELRKDGQFRKAEQIYIGLGEHDEAISMY 572          
BLAST of OSCA012500-RA vs. genbank:protein
Match: gi|827558504|ref|XP_012550385.1| (PREDICTED: intraflagellar transport protein osm-1 [Bombyx mori])

HSP 1 Score: 549.666 bits (1415), Expect = 5.016e-180
Identity = 281/392 (71.68%), Postives = 316/392 (80.61%), Query Frame = 0
Query:  271 QLAAKCYREVGDEARMFYLDKTVELAASVGDGDVTTGLNVATVRARLSIFAGDLPSAEEWYVKKAGKPELAIDMYKQFNRWAEAVALAEKTDRAAVAMLKQQHMDYLTSTGRLGEAGAALASSGDVQGAVRLWLRGGRARRAAALLLQHASLLXGAAMAARRARAQSRCAVAATCFAAAGYGTGGCCTYATCAEWWEMAGEISERRGDSRTAVEYYAKGNNFARAVQLAREACPAEVTSLEGMWGSWLVSSRQAGAAVPHLIEAGDTRGALAAALKAHHYRKALQIVQVIEDKESIREQCEQLGDHFISTQEWETAERVLSSCGMAERGVRAYNTAGRVADGLRLAAQHLTEEETRDIYLPLAQQMREDGQLRKAEQIYIGLGEPDEAISMY 662
            +LAAKCYRE+GDE+R FYL+K +E AA+ GDGDV  GL+ A VRARL+IF GDL +AE WY +++G PE AI MYKQFNRW +A+ALAEK DR +VA LKQQ+MDYLTSTGRLGEAGA LA++GDVQGAVRLWLRGGRARRAA+LLLQH  LL    +                             T     EWWEMAGE+SERRGD R AV+YYAKGNNFARAVQLARE+CP EVT LEG WG+WLVSSRQAGAAVPHLIEAGDTR ALAAA+KAHHYRKALQIVQ I+DKESI+EQCEQLGDH ISTQEWETAE+ L+SCGMAER VRAYN  GR ADGLRLAA  LTEE+TRDIY+PLA+++R+DGQLRKAEQIYIGLGE DEAISMY
Sbjct:   21 KLAAKCYREIGDESRTFYLEKIIEAAAAEGDGDVAAGLSSAEVRARLAIFNGDLATAEAWYARRSGHPERAIAMYKQFNRWTDAIALAEKADRTSVANLKQQYMDYLTSTGRLGEAGATLAAAGDVQGAVRLWLRGGRARRAASLLLQHPQLLRDNEL------------------------LDSVHTQLIQEEWWEMAGELSERRGDVRLAVDYYAKGNNFARAVQLARESCPGEVTHLEGQWGAWLVSSRQAGAAVPHLIEAGDTRAALAAAIKAHHYRKALQIVQAIDDKESIKEQCEQLGDHLISTQEWETAEKFLTSCGMAERCVRAYNGVGRFADGLRLAASQLTEEQTRDIYIPLAEELRKDGQLRKAEQIYIGLGEADEAISMY 388          
BLAST of OSCA012500-RA vs. genbank:protein
Match: gi|91094669|ref|XP_972505.1| (PREDICTED: intraflagellar transport protein 172 homolog [Tribolium castaneum] >gi|270016462|gb|EFA12908.1| Intraflagellar transport protein osm-1-like Protein [Tribolium castaneum])

HSP 1 Score: 397.127 bits (1019), Expect = 5.771e-118
Identity = 234/667 (35.08%), Postives = 361/667 (54.12%), Query Frame = 0
Query:    4 LSDNNNGQIPWAGGG--ERVYAAVGGACLLHRAGELSVVEYGLDRVLHTVRTERVNPHVLSVRINEGGDT--RKHLAYLLDRQTIAVVDLTTVVKFFGAIDLVEFNSKIGVQLGQWWXEARVDWLELNETGQLLLLRDTRRRLALLRLETGDKEIIASGVGFVQWIENCDAVVAQTPTHLLIWYSVWEADSAEMAECSGGVA--VEVNARR--VLFEGGQVPYLQLDEHRLAFNNALRSGDLAGCAKYLDGVGNNADVSSLWRQLAERALATDDIQLAAKCYREVGDEARMFYLDKTVELAASVGDGDVTTGLNVATVRARLSIFAGDLPSAEEWYVKKAGKPELAIDMYKQFNRWAEAVALAEKTDRAAVAMLKQQHMDYLTSTGRLGEAGAALASSGDVQGAVRLWLRGGRARRAAALLLQHASLLXGAAMAARRARAQSRCAVAATCFAAAGYGTGGCCTYATCAEWWEMAGEISERRGDSRTAVEYYAKGNNFARAVQLAREACPAEVTSLEGMWGSWLVSSRQAGAAVPHLIEAGDTRGALAAALKAHHYRKALQIVQVIEDKESIREQCEQLGDHFISTQEWETAERVLSSCGMAERGVRAYNTAGRVADGLRLAAQHLTEEETRDIYLPLAQQMREDGQLRKAEQIYIGLGEPDEAISMY 662
            L  N   ++PW   G  E+ Y      CL+  AGEL+++EYG D+VL +VRTE  NPH++SVR+NE   T   K LAYLLD +TI +VDL                   GV + Q   ++++DWLELNETG  LL RD ++RL L+   T +K+ I +GV FVQW+E  D  VAQ  T L IWY++   ++  +    G V   V  N +   V  +G  V  L+LDE  + F  A+   D A    +L+ +GN+ + S++W  L+  AL   ++QLA +C   +G+ A   +L +T+E + +  +           + ARLSI  GDL +AE  ++++ G  E A++MYK+ ++W EA+ LAE+     +  L+ +HM  L  +G+  + G  L      + A+ ++++ G+  R  +L+L++  LL   A+ A   +   +                         E +E A EI ER      A+E Y KG  + +AV LARE  P +V  LE  WG  LV S+Q  AA+ H IEAG T  AL  A+ A  ++KA+ I++VI+D+ES+++  + +  +F   +++ TAE++  S GM +  V  YN AG       LA+Q+L  +E  D+Y+  A Q+ E+G+ R AE++YI +  PD AI+MY
Sbjct:  387 LQRNLLSEVPWNNSGRHEKFYFDYASVCLVFNAGELTLIEYGDDQVLCSVRTEFANPHLISVRLNERISTSDNKKLAYLLDLKTICIVDLLN-----------------GVLIMQVTHDSKIDWLELNETGHKLLFRDKKQRLILVDTTTQNKQCIFTGVSFVQWVEGSDVAVAQANTSLAIWYNIEMPENPTIMSVKGDVTDVVRNNGKTEAVCIDGNNVYNLELDEGLVEFGTAIHDNDYARAVLFLESMGNSPEASAMWHNLSTIALKEHNLQLAERCNAALGNVATAHFLRETIEKSTNEEES--------PEIWARLSILNGDLTTAENIFLEQ-GDIENALNMYKKLHKWDEALRLAEQRGYDKLKQLQDEHMSVLLQSGQFEKVGQVLEKENKFEQALNMYIKSGKLLRVPSLVLKNEVLLKDHALIATVLKNLVK------------------------HEMFEAAAEIYERLDKIDLAMECYRKGKVWNKAVDLAREVSPDKVVDLEEEWGDSLVESKQLDAAISHFIEAGRTLKALDTAVLAKQWKKAVHIIRVIDDQESVKKYYDTIAGYFAKNRDFATAEKLYVSSGMYKEAVDMYNEAGHWEKAHNLASQYLEPDEVADMYIKKAAQLEENGKFRDAERLYISVNSPDLAIAMY 1003          
BLAST of OSCA012500-RA vs. genbank:protein
Match: gi|1133426088|ref|XP_019868848.1| (PREDICTED: LOW QUALITY PROTEIN: intraflagellar transport protein 172 homolog [Aethina tumida])

HSP 1 Score: 395.971 bits (1016), Expect = 1.229e-117
Identity = 222/667 (33.28%), Postives = 368/667 (55.17%), Query Frame = 0
Query:    4 LSDNNNGQIPWAGGG--ERVYAAVGGACLLHRAGELSVVEYGLDRVLHTVRTERVNPHVLSVRINEGGDTR--KHLAYLLDRQTIAVVDLTTVVKFFGAIDLVEFNSKIGVQLGQWWXEARVDWLELNETGQLLLLRDTRRRLALLRLETGDKEIIASGVGFVQWIENCDAVVAQTPTHLLIWYSVWEADSAEMAECSGGVA--VEVNARR--VLFEGGQVPYLQLDEHRLAFNNALRSGDLAGCAKYLDGVGNNADVSSLWRQLAERALATDDIQLAAKCYREVGDEARMFYLDKTVELAASVGDGDVTTGLNVATVRARLSIFAGDLPSAEEWYVKKAGKPELAIDMYKQFNRWAEAVALAEKTDRAAVAMLKQQHMDYLTSTGRLGEAGAALASSGDVQGAVRLWLRGGRARRAAALLLQHASLLXGAAMAARRARAQSRCAVAATCFAAAGYGTGGCCTYATCAEWWEMAGEISERRGDSRTAVEYYAKGNNFARAVQLAREACPAEVTSLEGMWGSWLVSSRQAGAAVPHLIEAGDTRGALAAALKAHHYRKALQIVQVIEDKESIREQCEQLGDHFISTQEWETAERVLSSCGMAERGVRAYNTAGRVADGLRLAAQHLTEEETRDIYLPLAQQMREDGQLRKAEQIYIGLGEPDEAISMY 662
            LS N   ++PW   G  E+ Y      CL+  AGEL+++EYG + VL +VRTE  NPH++SVR+NE   T   K LAYLLD +TI +VDL +                 GV +GQ   ++++DWLEL+ETG  LL RD ++RL L+   T  K+ I + VGF QW+E+ D  VAQ+  +L IWY++   ++  +    G V   +  N +   V  +G     ++LDE  + F  A+   D +    +L+ +GN+++  ++W  L+  A+   ++ LA +C+  +G+ +  +YL +T+ +  +  +    +  N   V ARLSI   DL +AE  Y+++ G  E A+ MYK  ++W EA+ LA++     +  LK++HM+ L  +G+  + G  L + G  + A+ ++L+  +  R   L+++H+ L+   +  A   ++  R                        ++ +E A EI E+      A+E Y KG  + +AV LAR   P +V  LE  WG  LV ++Q  AA+ H IEAG T  AL AA+ A  ++KA+ I++VI++ ES+++  E +G++F S +++ TAE++   CGM +  V  YN AG+      +A+ +L ++E  D+Y+  A+Q+ E G+ R AE++Y+ +  PD AI+MY
Sbjct:  385 LSKNLLSEVPWNNSGRYEKFYFENPSVCLVFNAGELTLIEYGDNDVLCSVRTEFANPHLISVRLNERNQTNNNKKLAYLLDLKTICIVDLVS-----------------GVTIGQINHDSKIDWLELSETGHKLLFRDKKQRLVLIDTYTHAKQTIFTEVGFAQWVESSDVAVAQSGNNLAIWYNIELPENPTIMTVKGDVTDIIRNNGKTEAVCVDGNNTINIELDEGLVEFGTAINDNDYSRAVLFLETMGNSSEAEAMWHSLSVIAIKQQNLLLAERCFAALGNVSVAYYLHETLLIGQNYSEKFNDSPNNCPEVWARLSILNNDLSTAENIYLEQ-GDIESALKMYKNLHKWDEALRLADQRGYEHIKELKEEHMNSLMQSGQFEKIGQVLENEGKYEEALNMYLKSNKLLRIPNLMIRHSELMEDHSSVANVLKSLLR------------------------SDHFEAAAEIYEKLDKPDLAMECYRKGKVWNKAVDLARNVSPNQVVQLEEEWGDSLVENKQMDAAISHYIEAGCTLKALDAAVNARQWKKAVHIIKVIDEPESVKKYYELIGNYFASVKDYSTAEKLYIKCGMYKTAVDMYNEAGQWEKAHSIASNYLDQDEVADMYIKHAEQLEEAGKYRDAERLYLSINSPDLAIAMY 1009          
The following BLAST results are available for this feature:
BLAST of OSCA012500-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|930649331|gb|KPI91679.1|0.000e+067.43Intraflagellar transport protein osm-1 [Papilio xu... [more]
gi|943953236|ref|XP_014359502.1|0.000e+067.58PREDICTED: intraflagellar transport protein 172 ho... [more]
gi|910337939|ref|XP_013172557.1|0.000e+067.43PREDICTED: intraflagellar transport protein osm-1 ... [more]
gi|930673866|gb|KPJ14298.1|0.000e+066.97Intraflagellar transport protein osm-1 [Papilio ma... [more]
gi|909569154|ref|XP_013140063.1|0.000e+067.43PREDICTED: intraflagellar transport protein osm-1,... [more]
gi|913318896|ref|XP_013190499.1|1.297e-11070.19PREDICTED: intraflagellar transport protein osm-1 ... [more]
gi|768430379|ref|XP_011556414.1|0.000e+067.24PREDICTED: intraflagellar transport protein osm-1-... [more]
gi|827558504|ref|XP_012550385.1|5.016e-18071.68PREDICTED: intraflagellar transport protein osm-1 ... [more]
gi|91094669|ref|XP_972505.1|5.771e-11835.08PREDICTED: intraflagellar transport protein 172 ho... [more]
gi|1133426088|ref|XP_019868848.1|1.229e-11733.28PREDICTED: LOW QUALITY PROTEIN: intraflagellar tra... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005515 protein binding
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011990Tetratricopeptide-like helical domainGENE3D1.25.40.10coord: 552..649
e-value: 7.9E-7
score: 27.8
coord: 457..487
e-value: 7.9E-7
score: 27.8
coord: 315..334
e-value: 7.9E-7
score: 27.8
coord: 254..280
e-value: 7.9E-7
score: 27.8
NoneNo IPR availablePANTHERPTHR15722:SF2INTRAFLAGELLAR TRANSPORT PROTEIN 172 HOMOLOGcoord: 28..448
NoneNo IPR availablePANTHERPTHR15722:SF2INTRAFLAGELLAR TRANSPORT PROTEIN 172 HOMOLOGcoord: 464..662
NoneNo IPR availablePANTHERPTHR15722IFT140/172-RELATEDcoord: 28..448
NoneNo IPR availablePANTHERPTHR15722IFT140/172-RELATEDcoord: 464..662

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_14327contignewscf_14327:282..4321 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA012500-RAOSCA012500-RAOstrinia scapulalismRNAnewscf_14327 282..4321 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA012500-PA ID=OSCA012500-PA|Name=OSCA012500-RA|organism=Ostrinia scapulalis|type=polypeptide|length=662bp
SYKLSDNNNGQIPWAGGGERVYAAVGGACLLHRAGELSVVEYGLDRVLHT
VRTERVNPHVLSVRINEGGDTRKHLAYLLDRQTIAVVDLTTVVKFFGAID
LVEFNSKIGVQLGQWWXEARVDWLELNETGQLLLLRDTRRRLALLRLETG
DKEIIASGVGFVQWIENCDAVVAQTPTHLLIWYSVWEADSAEMAECSGGV
AVEVNARRVLFEGGQVPYLQLDEHRLAFNNALRSGDLAGCAKYLDGVGNN
ADVSSLWRQLAERALATDDIQLAAKCYREVGDEARMFYLDKTVELAASVG
DGDVTTGLNVATVRARLSIFAGDLPSAEEWYVKKAGKPELAIDMYKQFNR
WAEAVALAEKTDRAAVAMLKQQHMDYLTSTGRLGEAGAALASSGDVQGAV
RLWLRGGRARRAAALLLQHASLLXGAAMAARRARAQSRCAVAATCFAAAG
YGTGGCCTYATCAEWWEMAGEISERRGDSRTAVEYYAKGNNFARAVQLAR
EACPAEVTSLEGMWGSWLVSSRQAGAAVPHLIEAGDTRGALAAALKAHHY
RKALQIVQVIEDKESIREQCEQLGDHFISTQEWETAERVLSSCGMAERGV
RAYNTAGRVADGLRLAAQHLTEEETRDIYLPLAQQMREDGQLRKAEQIYI
GLGEPDEAISMY
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
Vocabulary: INTERPRO
TermDefinition
IPR011990TPR-like_helical_dom