OSCA015086-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA015086-RA
Unique NameOSCA015086-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length134
Homology
BLAST of OSCA015086-RA vs. genbank:protein
Match: gi|827536156|ref|XP_012544942.1| (PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101741607, partial [Bombyx mori])

HSP 1 Score: 70.0922 bits (170), Expect = 8.584e-12
Identity = 34/52 (65.38%), Postives = 37/52 (71.15%), Query Frame = 0
Query:   48 KVLEWRPRTGKRSVGRPPTRWTDNLIKVAG---------RRCGNNWRRPMFS 90
            K+LEWRPRTGKRSVGRPPTRWTD+L+K AG         R  GN   RPMFS
Sbjct:  213 KILEWRPRTGKRSVGRPPTRWTDDLVKSAGSRWMQVAMDRHTGNLLERPMFS 264          
BLAST of OSCA015086-RA vs. genbank:protein
Match: gi|827540150|ref|XP_012553149.1| (PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101739909, partial [Bombyx mori])

HSP 1 Score: 70.8626 bits (172), Expect = 8.950e-12
Identity = 33/52 (63.46%), Postives = 39/52 (75.00%), Query Frame = 0
Query:   48 KVLEWRPRTGKRSVGRPPTRWTDNLIKVAG---------RRCGNNWRRPMFS 90
            K+LEWRPRTGKRSVGRPPTRWTD+L++ AG         RR G++  RPMFS
Sbjct:  323 KILEWRPRTGKRSVGRPPTRWTDDLVRTAGSRWMQVATDRRTGDHLERPMFS 374          
BLAST of OSCA015086-RA vs. genbank:protein
Match: gi|930650854|gb|KPI93198.1| (hypothetical protein RR46_10458 [Papilio xuthus])

HSP 1 Score: 67.3958 bits (163), Expect = 1.946e-10
Identity = 27/34 (79.41%), Postives = 31/34 (91.18%), Query Frame = 0
Query:   45 QW-TKVLEWRPRTGKRSVGRPPTRWTDNLIKVAG 77
            +W  KVLEWRPRTG+RSVGRPP RWTD+L+KVAG
Sbjct:    4 RWDNKVLEWRPRTGRRSVGRPPARWTDDLVKVAG 37          
BLAST of OSCA015086-RA vs. genbank:protein
Match: gi|930648975|gb|KPI91323.1| (hypothetical protein RR46_14827 [Papilio xuthus])

HSP 1 Score: 60.8474 bits (146), Expect = 9.907e-10
Identity = 26/30 (86.67%), Postives = 29/30 (96.67%), Query Frame = 0
Query:   48 KVLEWRPRTGKRSVGRPPTRWTDNLIKVAG 77
            KVLEWRPRTG+RSVGRPP RWTD+L+KVAG
Sbjct:   25 KVLEWRPRTGRRSVGRPPARWTDDLVKVAG 54          
BLAST of OSCA015086-RA vs. genbank:protein
Match: gi|930681186|gb|KPJ20726.1| (hypothetical protein RR46_00012 [Papilio xuthus])

HSP 1 Score: 59.6918 bits (143), Expect = 1.703e-9
Identity = 26/30 (86.67%), Postives = 29/30 (96.67%), Query Frame = 0
Query:   48 KVLEWRPRTGKRSVGRPPTRWTDNLIKVAG 77
            KVLEWRPRTG+RSVGRPP RWTD+L+KVAG
Sbjct:    8 KVLEWRPRTGRRSVGRPPARWTDDLVKVAG 37          
BLAST of OSCA015086-RA vs. genbank:protein
Match: gi|930681500|gb|KPJ21040.1| (hypothetical protein RR48_00071 [Papilio machaon])

HSP 1 Score: 59.6918 bits (143), Expect = 1.780e-9
Identity = 26/30 (86.67%), Postives = 29/30 (96.67%), Query Frame = 0
Query:   48 KVLEWRPRTGKRSVGRPPTRWTDNLIKVAG 77
            KVLEWRPRTG+RSVGRPP RWTD+L+KVAG
Sbjct:   16 KVLEWRPRTGRRSVGRPPARWTDDLVKVAG 45          
BLAST of OSCA015086-RA vs. genbank:protein
Match: gi|298204325|gb|ADI61811.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 64.3142 bits (155), Expect = 2.017e-9
Identity = 27/32 (84.38%), Postives = 30/32 (93.75%), Query Frame = 0
Query:   48 KVLEWRPRTGKRSVGRPPTRWTDNLIKVAGRR 79
            K+LEWRPRTGKRSVGRPPTRWTD+L+K AG R
Sbjct:  936 KILEWRPRTGKRSVGRPPTRWTDDLVKSAGSR 967          
BLAST of OSCA015086-RA vs. genbank:protein
Match: gi|827560966|ref|XP_012551328.1| (PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101744003 [Bombyx mori])

HSP 1 Score: 63.929 bits (154), Expect = 3.005e-9
Identity = 27/32 (84.38%), Postives = 30/32 (93.75%), Query Frame = 0
Query:   48 KVLEWRPRTGKRSVGRPPTRWTDNLIKVAGRR 79
            K+LEWRPRTGKRSVGRPPTRWTD+L+K AG R
Sbjct:  449 KILEWRPRTGKRSVGRPPTRWTDDLVKSAGSR 480          
BLAST of OSCA015086-RA vs. genbank:protein
Match: gi|298204327|gb|ADI61812.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 63.5438 bits (153), Expect = 3.857e-9
Identity = 25/30 (83.33%), Postives = 30/30 (100.00%), Query Frame = 0
Query:   48 KVLEWRPRTGKRSVGRPPTRWTDNLIKVAG 77
            K+LEWRPRTGKRSVGRPPTRWTD+L+K++G
Sbjct:  936 KILEWRPRTGKRSVGRPPTRWTDDLVKISG 965          
BLAST of OSCA015086-RA vs. genbank:protein
Match: gi|930656813|gb|KPI99136.1| (hypothetical protein RR46_02353 [Papilio xuthus])

HSP 1 Score: 58.151 bits (139), Expect = 7.580e-9
Identity = 25/31 (80.65%), Postives = 29/31 (93.55%), Query Frame = 0
Query:   47 TKVLEWRPRTGKRSVGRPPTRWTDNLIKVAG 77
            +KVL WRPRTG+RSVGRPP RWTD+L+KVAG
Sbjct:   13 SKVLVWRPRTGRRSVGRPPARWTDDLVKVAG 43          
The following BLAST results are available for this feature:
BLAST of OSCA015086-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 12
Match NameE-valueIdentityDescription
gi|827536156|ref|XP_012544942.1|8.584e-1265.38PREDICTED: LOW QUALITY PROTEIN: uncharacterized pr... [more]
gi|827540150|ref|XP_012553149.1|8.950e-1263.46PREDICTED: LOW QUALITY PROTEIN: uncharacterized pr... [more]
gi|930650854|gb|KPI93198.1|1.946e-1079.41hypothetical protein RR46_10458 [Papilio xuthus][more]
gi|930648975|gb|KPI91323.1|9.907e-1086.67hypothetical protein RR46_14827 [Papilio xuthus][more]
gi|930681186|gb|KPJ20726.1|1.703e-986.67hypothetical protein RR46_00012 [Papilio xuthus][more]
gi|930681500|gb|KPJ21040.1|1.780e-986.67hypothetical protein RR48_00071 [Papilio machaon][more]
gi|298204325|gb|ADI61811.1|2.017e-984.38endonuclease-reverse transcriptase [Bombyx mori][more]
gi|827560966|ref|XP_012551328.1|3.005e-984.38PREDICTED: LOW QUALITY PROTEIN: uncharacterized pr... [more]
gi|298204327|gb|ADI61812.1|3.857e-983.33endonuclease-reverse transcriptase [Bombyx mori][more]
gi|930656813|gb|KPI99136.1|7.580e-980.65hypothetical protein RR46_02353 [Papilio xuthus][more]

Pages

back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_200contignewscf_200:5035..6719 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA015086-RAOSCA015086-RAOstrinia scapulalismRNAnewscf_200 5035..6719 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA015086-PA ID=OSCA015086-PA|Name=OSCA015086-RA|organism=Ostrinia scapulalis|type=polypeptide|length=134bp
MIQTCNKILDKRWTDDIIKVAGKRWTQAATNRVTWKALGEAYVQQWTKVL
EWRPRTGKRSVGRPPTRWTDNLIKVAGRRCGNNWRRPMFSSGRPMAEMMM
MMKLDKAVLLQWRLDDLMMMMMMNRKLKVDRCVG
back to top