OSCA024044-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA024044-RA
Unique NameOSCA024044-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length120
Homology
BLAST of OSCA024044-RA vs. genbank:protein
Match: gi|134001247|gb|ABO45233.1| (reverse transcriptase [Ostrinia nubilalis] >gi|134001274|gb|ABO45235.1| reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 120.553 bits (301), Expect = 1.785e-30
Identity = 71/98 (72.45%), Postives = 76/98 (77.55%), Query Frame = 0
Query:    1 MGLIRRLKV-RRSIE----------------IRRRIKVTDIARGIAKMKWQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPFTRWTDDLVKVAGGA 81
            MGLIRRLKV +R++E                IRRR +VTDIAR IAK+KWQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRP TRWTDDLVKVAG  
Sbjct:  240 MGLIRRLKVTQRAMERAMLGVSLRDRIRNEEIRRRTRVTDIARRIAKIKWQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPPTRWTDDLVKVAGST 337          
BLAST of OSCA024044-RA vs. genbank:protein
Match: gi|134001323|gb|ABO45239.1| (reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 121.709 bits (304), Expect = 3.364e-30
Identity = 71/98 (72.45%), Postives = 76/98 (77.55%), Query Frame = 0
Query:    1 MGLIRRLKV-RRSIE----------------IRRRIKVTDIARGIAKMKWQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPFTRWTDDLVKVAGGA 81
            MGLIRRLKV +R++E                IRRR +VTDIAR IAK+KWQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRP TRWTDDLVKVAG  
Sbjct:  374 MGLIRRLKVTQRAMERAMLGVSLRDRIRNEEIRRRTRVTDIARRIAKIKWQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPPTRWTDDLVKVAGST 471          
BLAST of OSCA024044-RA vs. genbank:protein
Match: gi|134001215|gb|ABO45231.1| (reverse transcriptase [Ostrinia nubilalis] >gi|134001296|gb|ABO45237.1| reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 121.324 bits (303), Expect = 4.700e-30
Identity = 71/98 (72.45%), Postives = 76/98 (77.55%), Query Frame = 0
Query:    1 MGLIRRLKV-RRSIE----------------IRRRIKVTDIARGIAKMKWQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPFTRWTDDLVKVAGGA 81
            MGLIRRLKV +R++E                IRRR +VTDIAR IAK+KWQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRP TRWTDDLVKVAG  
Sbjct:  355 MGLIRRLKVTQRAMERAMLGVSLRDRIRNEEIRRRTRVTDIARRIAKIKWQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPPTRWTDDLVKVAGST 452          
BLAST of OSCA024044-RA vs. genbank:protein
Match: gi|357603461|gb|EHJ63790.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 112.849 bits (281), Expect = 4.413e-29
Identity = 55/70 (78.57%), Postives = 61/70 (87.14%), Query Frame = 0
Query:   11 RSIEIRRRIKVTDIARGIAKMKWQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPFTRWTDDLVKVAGG 80
            R+ EIRRR+K TDIA+ I+ +KWQWAGHIARR DGRWGRKVLEWRPR G+RSVGRP TRWTDDLVK AG 
Sbjct:   97 RNDEIRRRMKGTDIAKRISSLKWQWAGHIARRTDGRWGRKVLEWRPRIGKRSVGRPPTRWTDDLVKAAGS 166          
BLAST of OSCA024044-RA vs. genbank:protein
Match: gi|298204327|gb|ADI61812.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 114.005 bits (284), Expect = 5.109e-27
Identity = 49/60 (81.67%), Postives = 56/60 (93.33%), Query Frame = 0
Query:   20 KVTDIARGIAKMKWQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPFTRWTDDLVKVAG 79
            KV DIAR I+K+KWQWAGHIARR+DGRWGRK+LEWRPR G+RSVGRP TRWTDDLVK++G
Sbjct:  906 KVADIARRISKLKWQWAGHIARRSDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLVKISG 965          
BLAST of OSCA024044-RA vs. genbank:protein
Match: gi|838097688|gb|KLV34200.1| (hypothetical protein AB894_15325, partial [Piscirickettsia salmonis])

HSP 1 Score: 113.62 bits (283), Expect = 6.859e-27
Identity = 54/80 (67.50%), Postives = 66/80 (82.50%), Query Frame = 0
Query:    1 MGLIRRLKVRRSIEIRRRIKVTDIARGIAKMKWQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPFTRWTDDLVKVAGG 80
            +G+  R K+R ++EIR+R +VTDIA  I ++KWQWAGH+ARR DGRW RKV EWRPR GRRSVGRP TRWTDD+V+VAG 
Sbjct:  717 LGVSLRDKIR-NMEIRQRTRVTDIALKICRLKWQWAGHVARRTDGRWARKVTEWRPRTGRRSVGRPPTRWTDDIVRVAGS 795          
BLAST of OSCA024044-RA vs. genbank:protein
Match: gi|298204337|gb|ADI61817.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 112.849 bits (281), Expect = 1.401e-26
Identity = 59/96 (61.46%), Postives = 67/96 (69.79%), Query Frame = 0
Query:    1 MGLIRRLKVR-----------------RSIEIRRRIKVTDIARGIAKMKWQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPFTRWTDDLVKVAG 79
            MGL+RRLKV                  R+ EIRR+  VTDIA+ IA +KWQWAGHIAR  DGRWG+KVLEWRPR GRRSVGRP TRW DDL++ AG
Sbjct:  866 MGLMRRLKVTQRAMERAMLGVSLRDQIRNEEIRRKTMVTDIAQRIATLKWQWAGHIARGTDGRWGQKVLEWRPRTGRRSVGRPPTRWADDLLRFAG 961          
BLAST of OSCA024044-RA vs. genbank:protein
Match: gi|909577882|ref|XP_013144778.1| (PREDICTED: uncharacterized protein LOC106108224 [Papilio polytes])

HSP 1 Score: 111.694 bits (278), Expect = 3.284e-26
Identity = 62/96 (64.58%), Postives = 68/96 (70.83%), Query Frame = 0
Query:    2 GLIRRLKV-RRSIE----------------IRRRIKVTDIARGIAKMKWQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPFTRWTDDLVKVAGG 80
            G IRRLKV +R++E                IR R KVTDIAR I  +KW+WAGHIARR DGRWGR+VLEWRPR GRRSVGRP  RWTDDLVKVAG 
Sbjct:  648 GNIRRLKVTQRAMERAMLGVSLRDRVRNDAIRSRTKVTDIARRIVNLKWRWAGHIARRTDGRWGRRVLEWRPRIGRRSVGRPPARWTDDLVKVAGA 743          
BLAST of OSCA024044-RA vs. genbank:protein
Match: gi|827536156|ref|XP_012544942.1| (PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101741607, partial [Bombyx mori])

HSP 1 Score: 106.686 bits (265), Expect = 6.722e-26
Identity = 49/61 (80.33%), Postives = 54/61 (88.52%), Query Frame = 0
Query:   20 KVTDIARGIAKMKWQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPFTRWTDDLVKVAGG 80
            KV DIAR I+++KWQWAGHIARR DGRWGRK+LEWRPR G+RSVGRP TRWTDDLVK AG 
Sbjct:  183 KVADIARRISELKWQWAGHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLVKSAGS 243          
BLAST of OSCA024044-RA vs. genbank:protein
Match: gi|357612130|gb|EHJ67822.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 103.219 bits (256), Expect = 8.554e-26
Identity = 53/70 (75.71%), Postives = 59/70 (84.29%), Query Frame = 0
Query:   11 RSIEIRRRIKVTDIARGIAKMKWQWAGHIARRADGRWGRKVLEWRPRAGRRSVGRPFTRWTDDLVKVAGG 80
            R+ EIRRR +VTDIA+ I+ +KWQ AGHIARR DGRWGRKVLE RPR G+RSVGRP TRWTDDLVK AG 
Sbjct:   72 RNDEIRRRTRVTDIAKRISSLKWQCAGHIARRTDGRWGRKVLECRPRIGKRSVGRP-TRWTDDLVKAAGS 140          
The following BLAST results are available for this feature:
BLAST of OSCA024044-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|134001247|gb|ABO45233.1|1.785e-3072.45reverse transcriptase [Ostrinia nubilalis] >gi|134... [more]
gi|134001323|gb|ABO45239.1|3.364e-3072.45reverse transcriptase [Ostrinia nubilalis][more]
gi|134001215|gb|ABO45231.1|4.700e-3072.45reverse transcriptase [Ostrinia nubilalis] >gi|134... [more]
gi|357603461|gb|EHJ63790.1|4.413e-2978.57endonuclease-reverse transcriptase [Danaus plexipp... [more]
gi|298204327|gb|ADI61812.1|5.109e-2781.67endonuclease-reverse transcriptase [Bombyx mori][more]
gi|838097688|gb|KLV34200.1|6.859e-2767.50hypothetical protein AB894_15325, partial [Pisciri... [more]
gi|298204337|gb|ADI61817.1|1.401e-2661.46endonuclease-reverse transcriptase [Bombyx mori][more]
gi|909577882|ref|XP_013144778.1|3.284e-2664.58PREDICTED: uncharacterized protein LOC106108224 [P... [more]
gi|827536156|ref|XP_012544942.1|6.722e-2680.33PREDICTED: LOW QUALITY PROTEIN: uncharacterized pr... [more]
gi|357612130|gb|EHJ67822.1|8.554e-2675.71endonuclease-reverse transcriptase [Danaus plexipp... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0090305 nucleic acid phosphodiester bond hydrolysis
biological_process GO:0006278 RNA-dependent DNA biosynthetic process
molecular_function GO:0004519 endonuclease activity
molecular_function GO:0003964 RNA-directed DNA polymerase activity
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_25216contignewscf_25216:1513..1926 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA024044-RAOSCA024044-RAOstrinia scapulalismRNAnewscf_25216 1513..1926 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA024044-PA ID=OSCA024044-PA|Name=OSCA024044-RA|organism=Ostrinia scapulalis|type=polypeptide|length=120bp
MGLIRRLKVRRSIEIRRRIKVTDIARGIAKMKWQWAGHIARRADGRWGRK
VLEWRPRAGRRSVGRPFTRWTDDLVKVAGGAGPVFMENLGGGLCPAVDVF
RLKRTNERTNVINANVGEDR
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006278RNA-dependent DNA biosynthetic process
GO:0090305nucleic acid phosphodiester bond hydrolysis
Vocabulary: Molecular Function
TermDefinition
GO:0003964RNA-directed DNA polymerase activity
GO:0004519endonuclease activity