OSCA026099-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA026099-RA
Unique NameOSCA026099-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length146
Homology
BLAST of OSCA026099-RA vs. genbank:protein
Match: gi|827540150|ref|XP_012553149.1| (PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101739909, partial [Bombyx mori])

HSP 1 Score: 73.9442 bits (180), Expect = 1.008e-12
Identity = 42/81 (51.85%), Postives = 46/81 (56.79%), Query Frame = 0
Query:   33 ITDIARRISKLKWQWAGHIVRRTDGRWGSKILEWRTRPGNAAWDVHPQGEPTTLKKEGAGRRPQPTGQH--GKHWGRPMFS 111
            +TDIARRIS LKWQWAGHI RR+D RWG KILEWR R G  +    P      L +    R  Q       G H  RPMFS
Sbjct:  294 VTDIARRISTLKWQWAGHIARRSDCRWGGKILEWRPRTGKRSVGRPPTRWTDDLVRTAGSRWMQVATDRRTGDHLERPMFS 374          
BLAST of OSCA026099-RA vs. genbank:protein
Match: gi|298204327|gb|ADI61812.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 73.1738 bits (178), Expect = 2.842e-12
Identity = 32/39 (82.05%), Postives = 34/39 (87.18%), Query Frame = 0
Query:   33 ITDIARRISKLKWQWAGHIVRRTDGRWGSKILEWRTRPG 71
            + DIARRISKLKWQWAGHI RR+DGRWG KILEWR R G
Sbjct:  907 VADIARRISKLKWQWAGHIARRSDGRWGRKILEWRPRTG 945          
BLAST of OSCA026099-RA vs. genbank:protein
Match: gi|827536156|ref|XP_012544942.1| (PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101741607, partial [Bombyx mori])

HSP 1 Score: 71.633 bits (174), Expect = 2.908e-12
Identity = 42/81 (51.85%), Postives = 45/81 (55.56%), Query Frame = 0
Query:   33 ITDIARRISKLKWQWAGHIVRRTDGRWGSKILEWRTRPGNAAWDVHPQGEPTTLKKEGAGRRPQPTGQH--GKHWGRPMFS 111
            + DIARRIS+LKWQWAGHI RR DGRWG KILEWR R G  +    P      L K    R  Q       G    RPMFS
Sbjct:  184 VADIARRISELKWQWAGHIARREDGRWGRKILEWRPRTGKRSVGRPPTRWTDDLVKSAGSRWMQVAMDRHTGNLLERPMFS 264          
BLAST of OSCA026099-RA vs. genbank:protein
Match: gi|134001323|gb|ABO45239.1| (reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 71.633 bits (174), Expect = 8.831e-12
Identity = 30/39 (76.92%), Postives = 34/39 (87.18%), Query Frame = 0
Query:   33 ITDIARRISKLKWQWAGHIVRRTDGRWGSKILEWRTRPG 71
            +TDIARRI+K+KWQWAGHI RR DGRWG K+LEWR R G
Sbjct:  411 VTDIARRIAKIKWQWAGHIARRADGRWGRKVLEWRPRAG 449          
BLAST of OSCA026099-RA vs. genbank:protein
Match: gi|134001215|gb|ABO45231.1| (reverse transcriptase [Ostrinia nubilalis] >gi|134001296|gb|ABO45237.1| reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 71.2478 bits (173), Expect = 1.009e-11
Identity = 30/39 (76.92%), Postives = 34/39 (87.18%), Query Frame = 0
Query:   33 ITDIARRISKLKWQWAGHIVRRTDGRWGSKILEWRTRPG 71
            +TDIARRI+K+KWQWAGHI RR DGRWG K+LEWR R G
Sbjct:  392 VTDIARRIAKIKWQWAGHIARRADGRWGRKVLEWRPRAG 430          
BLAST of OSCA026099-RA vs. genbank:protein
Match: gi|134001247|gb|ABO45233.1| (reverse transcriptase [Ostrinia nubilalis] >gi|134001274|gb|ABO45235.1| reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 70.8626 bits (172), Expect = 1.033e-11
Identity = 30/39 (76.92%), Postives = 34/39 (87.18%), Query Frame = 0
Query:   33 ITDIARRISKLKWQWAGHIVRRTDGRWGSKILEWRTRPG 71
            +TDIARRI+K+KWQWAGHI RR DGRWG K+LEWR R G
Sbjct:  277 VTDIARRIAKIKWQWAGHIARRADGRWGRKVLEWRPRAG 315          
BLAST of OSCA026099-RA vs. genbank:protein
Match: gi|189181684|ref|NP_001121193.1| (phosphatidylinositol 3-kinase 60 [Bombyx mori] >gi|186898235|gb|ACC94001.1| phosphatidylinositol 3-kinase 60 [Bombyx mori])

HSP 1 Score: 71.2478 bits (173), Expect = 1.242e-11
Identity = 29/42 (69.05%), Postives = 33/42 (78.57%), Query Frame = 0
Query:   33 ITDIARRISKLKWQWAGHIVRRTDGRWGSKILEWRTRPGNAA 74
            +TDIA+RI  LKWQW GHI RRTDGRWG K+LEWR R  + A
Sbjct:  123 VTDIAQRIVTLKWQWTGHIARRTDGRWGQKVLEWRPRLEDVA 164          
BLAST of OSCA026099-RA vs. genbank:protein
Match: gi|357603461|gb|EHJ63790.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 68.5514 bits (166), Expect = 1.380e-11
Identity = 31/38 (81.58%), Postives = 33/38 (86.84%), Query Frame = 0
Query:   34 TDIARRISKLKWQWAGHIVRRTDGRWGSKILEWRTRPG 71
            TDIA+RIS LKWQWAGHI RRTDGRWG K+LEWR R G
Sbjct:  108 TDIAKRISSLKWQWAGHIARRTDGRWGRKVLEWRPRIG 145          
BLAST of OSCA026099-RA vs. genbank:protein
Match: gi|298204325|gb|ADI61811.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 70.8626 bits (172), Expect = 1.664e-11
Identity = 31/39 (79.49%), Postives = 33/39 (84.62%), Query Frame = 0
Query:   33 ITDIARRISKLKWQWAGHIVRRTDGRWGSKILEWRTRPG 71
            + DIARRIS+LKWQWAGHI RR DGRWG KILEWR R G
Sbjct:  907 VADIARRISELKWQWAGHIARREDGRWGRKILEWRPRTG 945          
BLAST of OSCA026099-RA vs. genbank:protein
Match: gi|298204323|gb|ADI61810.1| (endonuclease-reverse transcriptase [Bombyx mori])

HSP 1 Score: 69.707 bits (169), Expect = 3.816e-11
Identity = 29/39 (74.36%), Postives = 33/39 (84.62%), Query Frame = 0
Query:   33 ITDIARRISKLKWQWAGHIVRRTDGRWGSKILEWRTRPG 71
            + DIARR+SKLKWQWAGHI RRTD RWG ++LEWR R G
Sbjct:  899 VIDIARRVSKLKWQWAGHICRRTDNRWGRRVLEWRPRTG 937          
The following BLAST results are available for this feature:
BLAST of OSCA026099-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|827540150|ref|XP_012553149.1|1.008e-1251.85PREDICTED: LOW QUALITY PROTEIN: uncharacterized pr... [more]
gi|298204327|gb|ADI61812.1|2.842e-1282.05endonuclease-reverse transcriptase [Bombyx mori][more]
gi|827536156|ref|XP_012544942.1|2.908e-1251.85PREDICTED: LOW QUALITY PROTEIN: uncharacterized pr... [more]
gi|134001323|gb|ABO45239.1|8.831e-1276.92reverse transcriptase [Ostrinia nubilalis][more]
gi|134001215|gb|ABO45231.1|1.009e-1176.92reverse transcriptase [Ostrinia nubilalis] >gi|134... [more]
gi|134001247|gb|ABO45233.1|1.033e-1176.92reverse transcriptase [Ostrinia nubilalis] >gi|134... [more]
gi|189181684|ref|NP_001121193.1|1.242e-1169.05phosphatidylinositol 3-kinase 60 [Bombyx mori] >gi... [more]
gi|357603461|gb|EHJ63790.1|1.380e-1181.58endonuclease-reverse transcriptase [Danaus plexipp... [more]
gi|298204325|gb|ADI61811.1|1.664e-1179.49endonuclease-reverse transcriptase [Bombyx mori][more]
gi|298204323|gb|ADI61810.1|3.816e-1174.36endonuclease-reverse transcriptase [Bombyx mori][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0090305 nucleic acid phosphodiester bond hydrolysis
biological_process GO:0016310 phosphorylation
biological_process GO:0006278 RNA-dependent DNA biosynthetic process
molecular_function GO:0004519 endonuclease activity
molecular_function GO:0003964 RNA-directed DNA polymerase activity
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_48567contignewscf_48567:466..906 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA026099-RAOSCA026099-RAOstrinia scapulalismRNAnewscf_48567 466..906 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA026099-PA ID=OSCA026099-PA|Name=OSCA026099-RA|organism=Ostrinia scapulalis|type=polypeptide|length=146bp
RHGPTLVRLRISSFLIRSRKETPSIARHNPKNITDIARRISKLKWQWAGH
IVRRTDGRWGSKILEWRTRPGNAAWDVHPQGEPTTLKKEGAGRRPQPTGQ
HGKHWGRPMFSSGRPVAEMMMMMTWPVDQAKSGPSHWKTVYSMYLT
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0016310phosphorylation
GO:0006278RNA-dependent DNA biosynthetic process
GO:0090305nucleic acid phosphodiester bond hydrolysis
Vocabulary: Molecular Function
TermDefinition
GO:0003964RNA-directed DNA polymerase activity
GO:0004519endonuclease activity