OSCA026100-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA026100-RA
Unique NameOSCA026100-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length64
Homology
BLAST of OSCA026100-RA vs. genbank:protein
Match: gi|930660157|gb|KPJ02152.1| (hypothetical protein RR46_03427 [Papilio xuthus])

HSP 1 Score: 57.3806 bits (137), Expect = 4.928e-9
Identity = 29/45 (64.44%), Postives = 33/45 (73.33%), Query Frame = 0
Query:   20 CVGRPPVRWTDDLVKVTGRTWMRAAQLYRSSWKSLGRPLSSSRRH 64
             VGRPP RWTDDLVKV G +WM+ AQ+ RSSW+SLG    SS R 
Sbjct:   29 IVGRPPPRWTDDLVKVAGVSWMQVAQV-RSSWRSLGEAYPSSERR 72          
BLAST of OSCA026100-RA vs. genbank:protein
Match: gi|930661989|gb|KPJ03810.1| (hypothetical protein RR46_01160 [Papilio xuthus])

HSP 1 Score: 55.8398 bits (133), Expect = 8.812e-9
Identity = 28/36 (77.78%), Postives = 30/36 (83.33%), Query Frame = 0
Query:   20 CVGRPPVRWTDDLVKVTGRTWMRAAQLYRSSWKSLG 55
             VGRPP RWTDDLVKVTG +WMR AQ  RSSW+SLG
Sbjct:   42 SVGRPPARWTDDLVKVTGASWMRVAQ-DRSSWRSLG 76          
The following BLAST results are available for this feature:
BLAST of OSCA026100-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 2
Match NameE-valueIdentityDescription
gi|930660157|gb|KPJ02152.1|4.928e-964.44hypothetical protein RR46_03427 [Papilio xuthus][more]
gi|930661989|gb|KPJ03810.1|8.812e-977.78hypothetical protein RR46_01160 [Papilio xuthus][more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_28225contignewscf_28225:1343..1537 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA026100-RAOSCA026100-RAOstrinia scapulalismRNAnewscf_28225 1343..1537 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA026100-PA ID=OSCA026100-PA|Name=OSCA026100-RA|organism=Ostrinia scapulalis|type=polypeptide|length=64bp
MNSSPFQKSFRVATTGWKTCVGRPPVRWTDDLVKVTGRTWMRAAQLYRSS
WKSLGRPLSSSRRH
back to top