OSCA026102-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA026102-RA
Unique NameOSCA026102-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length53
Homology
BLAST of OSCA026102-RA vs. genbank:protein
Match: gi|338858968|gb|AEJ33048.1| (adipose triglyceride lipase [Manduca sexta])

HSP 1 Score: 89.7373 bits (221), Expect = 9.171e-20
Identity = 38/53 (71.70%), Postives = 49/53 (92.45%), Query Frame = 0
Query:    1 MSKSLWKLSWNVLQQLHGFVYSAHDRSEAAAKIYYKLTMDSKKEGSDGYQLDR 53
            MSKSLW+LS N+LQQLHGFVY++HDRSE AA+IYYKLT ++K+E ++GYQL+R
Sbjct:  349 MSKSLWRLSLNLLQQLHGFVYTSHDRSEVAARIYYKLTAEAKREMNEGYQLER 401          
BLAST of OSCA026102-RA vs. genbank:protein
Match: gi|569534449|gb|AHE57674.1| (adipose triglyceride lipase [Manduca sexta])

HSP 1 Score: 89.7373 bits (221), Expect = 9.261e-20
Identity = 38/53 (71.70%), Postives = 49/53 (92.45%), Query Frame = 0
Query:    1 MSKSLWKLSWNVLQQLHGFVYSAHDRSEAAAKIYYKLTMDSKKEGSDGYQLDR 53
            MSKSLW+LS N+LQQLHGFVY++HDRSE AA+IYYKLT ++K+E ++GYQL+R
Sbjct:  349 MSKSLWRLSLNLLQQLHGFVYTSHDRSEVAARIYYKLTAEAKREMNEGYQLER 401          
BLAST of OSCA026102-RA vs. genbank:protein
Match: gi|914557797|gb|KOB66324.1| (Adipose triglyceride lipase, partial [Operophtera brumata])

HSP 1 Score: 84.7297 bits (208), Expect = 4.040e-18
Identity = 37/53 (69.81%), Postives = 46/53 (86.79%), Query Frame = 0
Query:    1 MSKSLWKLSWNVLQQLHGFVYSAHDRSEAAAKIYYKLTMDSKKEGSDGYQLDR 53
            MSKSLWKLS N++QQLH FVY++HDRS  AA+IYYKLT ++KKE  +GYQL+R
Sbjct:  349 MSKSLWKLSLNLIQQLHCFVYTSHDRSGDAARIYYKLTGETKKEAHEGYQLER 401          
BLAST of OSCA026102-RA vs. genbank:protein
Match: gi|930658855|gb|KPJ01037.1| (Patatin-like phospholipase domain-containing protein 2 [Papilio xuthus])

HSP 1 Score: 85.1149 bits (209), Expect = 4.760e-18
Identity = 37/53 (69.81%), Postives = 48/53 (90.57%), Query Frame = 0
Query:    1 MSKSLWKLSWNVLQQLHGFVYSAHDRSEAAAKIYYKLTMDSKKEGSDGYQLDR 53
            MSKSLW+LSW++L+QLH FVYSAHDRS+AAA+IYYKL +++KK+  D Y+LDR
Sbjct:  383 MSKSLWRLSWSLLRQLHAFVYSAHDRSDAAARIYYKLALEAKKDTED-YRLDR 434          
BLAST of OSCA026102-RA vs. genbank:protein
Match: gi|910342950|ref|XP_013175222.1| (PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC106123439 [Papilio xuthus])

HSP 1 Score: 83.9593 bits (206), Expect = 1.131e-17
Identity = 37/53 (69.81%), Postives = 48/53 (90.57%), Query Frame = 0
Query:    1 MSKSLWKLSWNVLQQLHGFVYSAHDRSEAAAKIYYKLTMDSKKEGSDGYQLDR 53
            MSKSLW+LSW++L+QLH FVYSAHDRS+AAA+IYYKL +++KK+  D Y+LDR
Sbjct:  348 MSKSLWRLSWSLLRQLHAFVYSAHDRSDAAARIYYKLALEAKKDTED-YRLDR 399          
BLAST of OSCA026102-RA vs. genbank:protein
Match: gi|943947662|ref|XP_014356936.1| (PREDICTED: uncharacterized protein LOC106709607 [Papilio machaon])

HSP 1 Score: 83.9593 bits (206), Expect = 1.176e-17
Identity = 37/53 (69.81%), Postives = 48/53 (90.57%), Query Frame = 0
Query:    1 MSKSLWKLSWNVLQQLHGFVYSAHDRSEAAAKIYYKLTMDSKKEGSDGYQLDR 53
            MSKSLW+LSW++L+QLH FVYSAHDRS+AAA+IYYKL +++KK+  D Y+LDR
Sbjct:  348 MSKSLWRLSWSLLRQLHAFVYSAHDRSDAAARIYYKLALEAKKDTED-YRLDR 399          
BLAST of OSCA026102-RA vs. genbank:protein
Match: gi|930675990|gb|KPJ16220.1| (Patatin-like phospholipase domain-containing protein 2 [Papilio machaon])

HSP 1 Score: 83.1889 bits (204), Expect = 2.367e-17
Identity = 37/53 (69.81%), Postives = 48/53 (90.57%), Query Frame = 0
Query:    1 MSKSLWKLSWNVLQQLHGFVYSAHDRSEAAAKIYYKLTMDSKKEGSDGYQLDR 53
            MSKSLW+LSW++L+QLH FVYSAHDRS+AAA+IYYKL +++KK+  D Y+LDR
Sbjct:  383 MSKSLWRLSWSLLRQLHAFVYSAHDRSDAAARIYYKLALEAKKDTED-YRLDR 434          

HSP 2 Score: 83.1889 bits (204), Expect = 2.367e-17
Identity = 37/53 (69.81%), Postives = 48/53 (90.57%), Query Frame = 0
Query:    1 MSKSLWKLSWNVLQQLHGFVYSAHDRSEAAAKIYYKLTMDSKKEGSDGYQLDR 53
            MSKSLW+LSW++L+QLH FVYSAHDRS+AAA+IYYKL +++KK+  D Y+LDR
Sbjct:  443 MSKSLWRLSWSLLRQLHAFVYSAHDRSDAAARIYYKLALEAKKDTED-YRLDR 494          
BLAST of OSCA026102-RA vs. genbank:protein
Match: gi|909570249|ref|XP_013140662.1| (PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC106105009 [Papilio polytes])

HSP 1 Score: 82.0333 bits (201), Expect = 5.756e-17
Identity = 37/53 (69.81%), Postives = 48/53 (90.57%), Query Frame = 0
Query:    1 MSKSLWKLSWNVLQQLHGFVYSAHDRSEAAAKIYYKLTMDSKKEGSDGYQLDR 53
            MSKSLW+LSW++L+QLH FVYSAHDRS+AAA+IYYKL +++KK+  D Y+LDR
Sbjct:  348 MSKSLWRLSWSLLRQLHAFVYSAHDRSDAAARIYYKLALEAKKDTED-YRLDR 399          
BLAST of OSCA026102-RA vs. genbank:protein
Match: gi|509183819|gb|JAA90030.1| (adipose triglyceride lipase brummer, partial [Pararge aegeria])

HSP 1 Score: 68.5514 bits (166), Expect = 3.174e-13
Identity = 31/44 (70.45%), Postives = 39/44 (88.64%), Query Frame = 0
Query:    1 MSKSLWKLSWNVLQQLHGFVYSAHDRSEAAAKIYYKLTMDSKKE 44
            MSKSLWKLSW +++QLH F+YSAHDRS+ AA+IYYKL+MD + E
Sbjct:  123 MSKSLWKLSWKLVRQLHAFLYSAHDRSD-AARIYYKLSMDHRDE 165          
BLAST of OSCA026102-RA vs. genbank:protein
Match: gi|357612342|gb|EHJ67935.1| (adipose triglyceride lipase brummer [Danaus plexippus])

HSP 1 Score: 65.4698 bits (158), Expect = 3.920e-11
Identity = 32/53 (60.38%), Postives = 42/53 (79.25%), Query Frame = 0
Query:    1 MSKSLWKLSWNVLQQLHGFVYSAHDRSEAAAKIYYKLTMDSKKEGSDGYQLDR 53
            MSK+LWK+SW + +QLHGF+YSA DRSE AA+IYYKL+    +E  D ++LDR
Sbjct:  349 MSKTLWKVSWQIARQLHGFLYSAPDRSE-AARIYYKLS----QEHRDEHRLDR 396          
The following BLAST results are available for this feature:
BLAST of OSCA026102-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 10
Match NameE-valueIdentityDescription
gi|338858968|gb|AEJ33048.1|9.171e-2071.70adipose triglyceride lipase [Manduca sexta][more]
gi|569534449|gb|AHE57674.1|9.261e-2071.70adipose triglyceride lipase [Manduca sexta][more]
gi|914557797|gb|KOB66324.1|4.040e-1869.81Adipose triglyceride lipase, partial [Operophtera ... [more]
gi|930658855|gb|KPJ01037.1|4.760e-1869.81Patatin-like phospholipase domain-containing prote... [more]
gi|910342950|ref|XP_013175222.1|1.131e-1769.81PREDICTED: LOW QUALITY PROTEIN: uncharacterized pr... [more]
gi|943947662|ref|XP_014356936.1|1.176e-1769.81PREDICTED: uncharacterized protein LOC106709607 [P... [more]
gi|930675990|gb|KPJ16220.1|2.367e-1769.81Patatin-like phospholipase domain-containing prote... [more]
gi|909570249|ref|XP_013140662.1|5.756e-1769.81PREDICTED: LOW QUALITY PROTEIN: uncharacterized pr... [more]
gi|509183819|gb|JAA90030.1|3.174e-1370.45adipose triglyceride lipase brummer, partial [Para... [more]
gi|357612342|gb|EHJ67935.1|3.920e-1160.38adipose triglyceride lipase brummer [Danaus plexip... [more]
back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006629 lipid metabolic process
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_6767contignewscf_6767:8422..8580 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA026102-RAOSCA026102-RAOstrinia scapulalismRNAnewscf_6767 8422..8580 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA026102-PA ID=OSCA026102-PA|Name=OSCA026102-RA|organism=Ostrinia scapulalis|type=polypeptide|length=53bp
MSKSLWKLSWNVLQQLHGFVYSAHDRSEAAAKIYYKLTMDSKKEGSDGYQ
LDR
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006629lipid metabolic process