OSCA026103-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA026103-RA
Unique NameOSCA026103-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length109
Homology
BLAST of OSCA026103-RA vs. genbank:protein
Match: gi|913298579|ref|XP_013192900.1| (PREDICTED: blood vessel epicardial substance-like [Amyelois transitella])

HSP 1 Score: 201.06 bits (510), Expect = 9.737e-62
Identity = 88/102 (86.27%), Postives = 97/102 (95.10%), Query Frame = 0
Query:    1 SMWDMYLNHCPKWRPINHVFFQVANIFFLLAFLAPHTPSGLIWMRVGLVLGCAFLGVWGWSVECYLDAVLWNGAFIVINFVYFSVQFYLLRPIKFHKDIEEV 102
            +MWD+YLNHCPKWRPINHVFFQVANIFFLL+FLAPHT SGLIW+RV LVLGCAFLG+W WS+ECYLDAVLWN  F+VINFVYF+VQFYL+RPIKFHKDIEEV
Sbjct:   64 TMWDLYLNHCPKWRPINHVFFQVANIFFLLSFLAPHTSSGLIWLRVALVLGCAFLGLWAWSIECYLDAVLWNSVFVVINFVYFAVQFYLMRPIKFHKDIEEV 165          
BLAST of OSCA026103-RA vs. genbank:protein
Match: gi|357621046|gb|EHJ73019.1| (hypothetical protein KGM_02476 [Danaus plexippus])

HSP 1 Score: 197.208 bits (500), Expect = 6.662e-61
Identity = 87/102 (85.29%), Postives = 96/102 (94.12%), Query Frame = 0
Query:    1 SMWDMYLNHCPKWRPINHVFFQVANIFFLLAFLAPHTPSGLIWMRVGLVLGCAFLGVWGWSVECYLDAVLWNGAFIVINFVYFSVQFYLLRPIKFHKDIEEV 102
            SMWD+YLNHCPKWRPINH+FFQ AN+FFLL+FLAPHTPSGLIW+RV L+LGC+F G+W WSVECYLDAV+WN  FIVINFVYFSVQFYLLRPIKFHKDIEEV
Sbjct:   59 SMWDVYLNHCPKWRPINHIFFQTANVFFLLSFLAPHTPSGLIWLRVALILGCSFSGLWAWSVECYLDAVVWNCVFIVINFVYFSVQFYLLRPIKFHKDIEEV 160          
BLAST of OSCA026103-RA vs. genbank:protein
Match: gi|443429440|gb|AGC92724.1| (blood vessel epicardial substance-like protein [Heliconius erato])

HSP 1 Score: 198.364 bits (503), Expect = 7.017e-61
Identity = 84/102 (82.35%), Postives = 97/102 (95.10%), Query Frame = 0
Query:    1 SMWDMYLNHCPKWRPINHVFFQVANIFFLLAFLAPHTPSGLIWMRVGLVLGCAFLGVWGWSVECYLDAVLWNGAFIVINFVYFSVQFYLLRPIKFHKDIEEV 102
            SMWDMYLNHCPKWRPINH+FFQ AN+FFLL+FLAPHTPSGL+W+RV L++GCAF G+W WS+ECYLDAV+WN AF+VINFVYF+VQFYLLRPIKFH+DIEEV
Sbjct:   61 SMWDMYLNHCPKWRPINHIFFQAANVFFLLSFLAPHTPSGLLWLRVALIIGCAFSGLWAWSIECYLDAVVWNSAFVVINFVYFAVQFYLLRPIKFHRDIEEV 162          
BLAST of OSCA026103-RA vs. genbank:protein
Match: gi|930675975|gb|KPJ16205.1| (Blood vessel epicardial substance-B [Papilio machaon])

HSP 1 Score: 187.578 bits (475), Expect = 1.971e-58
Identity = 81/104 (77.88%), Postives = 95/104 (91.35%), Query Frame = 0
Query:    1 SMWDMYLNHCPKWRPINHVFFQVANIFFLLAFLAPHTPSGLIWMRVGLVLGCAFLGVWGWSVECYLDAVLWNGAFIVINFVYFSVQFYLLRPIKFHKDIEEVSA 104
            SMWDMYL+HCPKWRP+NH+FFQVAN  FL +FLAPHTP+GL+W+RV LVLGCAF G+W WSV+CYLDAVLWN AF+VINFVYF+VQFYL+RPIKFHK+IEE + 
Sbjct:   61 SMWDMYLHHCPKWRPVNHIFFQVANACFLASFLAPHTPAGLVWLRVALVLGCAFSGLWAWSVQCYLDAVLWNSAFVVINFVYFAVQFYLMRPIKFHKEIEERTG 164          
BLAST of OSCA026103-RA vs. genbank:protein
Match: gi|909567805|ref|XP_013139328.1| (PREDICTED: blood vessel epicardial substance-like [Papilio polytes])

HSP 1 Score: 188.734 bits (478), Expect = 2.109e-57
Identity = 82/102 (80.39%), Postives = 94/102 (92.16%), Query Frame = 0
Query:    1 SMWDMYLNHCPKWRPINHVFFQVANIFFLLAFLAPHTPSGLIWMRVGLVLGCAFLGVWGWSVECYLDAVLWNGAFIVINFVYFSVQFYLLRPIKFHKDIEEV 102
            SMWD+YL+HCPKWRP+NH+FFQVAN  FL +FLAPHTP+GL+W+RV LVLGC F G+W WSV+CYLDAVLWN AFIVINFVYF+VQFYL+RPIKFHKDIEEV
Sbjct:   61 SMWDVYLHHCPKWRPVNHIFFQVANACFLASFLAPHTPAGLVWLRVALVLGCTFSGLWAWSVQCYLDAVLWNSAFIVINFVYFAVQFYLMRPIKFHKDIEEV 162          
BLAST of OSCA026103-RA vs. genbank:protein
Match: gi|943947648|ref|XP_014356931.1| (PREDICTED: blood vessel epicardial substance-like [Papilio machaon])

HSP 1 Score: 189.504 bits (480), Expect = 2.432e-57
Identity = 82/102 (80.39%), Postives = 95/102 (93.14%), Query Frame = 0
Query:    1 SMWDMYLNHCPKWRPINHVFFQVANIFFLLAFLAPHTPSGLIWMRVGLVLGCAFLGVWGWSVECYLDAVLWNGAFIVINFVYFSVQFYLLRPIKFHKDIEEV 102
            SMWDMYL+HCPKWRP+NH+FFQVAN  FL +FLAPHTP+GL+W+RV LVLGCAF G+W WSV+CYLDAVLWN AF+VINFVYF+VQFYL+RPIKFHK+IEEV
Sbjct:   61 SMWDMYLHHCPKWRPVNHIFFQVANACFLASFLAPHTPAGLVWLRVALVLGCAFSGLWAWSVQCYLDAVLWNSAFVVINFVYFAVQFYLMRPIKFHKEIEEV 162          
BLAST of OSCA026103-RA vs. genbank:protein
Match: gi|910325815|ref|XP_013166038.1| (PREDICTED: blood vessel epicardial substance-like [Papilio xuthus])

HSP 1 Score: 186.422 bits (472), Expect = 4.601e-56
Identity = 80/102 (78.43%), Postives = 96/102 (94.12%), Query Frame = 0
Query:    1 SMWDMYLNHCPKWRPINHVFFQVANIFFLLAFLAPHTPSGLIWMRVGLVLGCAFLGVWGWSVECYLDAVLWNGAFIVINFVYFSVQFYLLRPIKFHKDIEEV 102
            SMWD+YL+HCPKWRP+NH+FFQ+AN  FL++FLAPHTP+GL+W+RV LVLGCAF G+W WSV+CYLDAVLWN AF+VINFVYF+VQFYL+RPIKFHK+IEEV
Sbjct:   61 SMWDVYLHHCPKWRPVNHIFFQLANGCFLVSFLAPHTPAGLVWLRVALVLGCAFSGLWAWSVQCYLDAVLWNSAFVVINFVYFAVQFYLMRPIKFHKEIEEV 162          
BLAST of OSCA026103-RA vs. genbank:protein
Match: gi|930663653|gb|KPJ05157.1| (Blood vessel epicardial substance [Papilio xuthus])

HSP 1 Score: 186.037 bits (471), Expect = 6.388e-56
Identity = 80/102 (78.43%), Postives = 96/102 (94.12%), Query Frame = 0
Query:    1 SMWDMYLNHCPKWRPINHVFFQVANIFFLLAFLAPHTPSGLIWMRVGLVLGCAFLGVWGWSVECYLDAVLWNGAFIVINFVYFSVQFYLLRPIKFHKDIEEV 102
            SMWD+YL+HCPKWRP+NH+FFQ+AN  FL++FLAPHTP+GL+W+RV LVLGCAF G+W WSV+CYLDAVLWN AF+VINFVYF+VQFYL+RPIKFHK+IEEV
Sbjct:   61 SMWDVYLHHCPKWRPVNHIFFQLANGCFLVSFLAPHTPAGLVWLRVALVLGCAFSGLWAWSVQCYLDAVLWNSAFVVINFVYFAVQFYLMRPIKFHKEIEEV 162          
BLAST of OSCA026103-RA vs. genbank:protein
Match: gi|827556894|ref|XP_012549761.1| (PREDICTED: uncharacterized protein LOC101745580 isoform X1 [Bombyx mori])

HSP 1 Score: 185.267 bits (469), Expect = 2.116e-54
Identity = 81/102 (79.41%), Postives = 93/102 (91.18%), Query Frame = 0
Query:    1 SMWDMYLNHCPKWRPINHVFFQVANIFFLLAFLAPHTPSGLIWMRVGLVLGCAFLGVWGWSVECYLDAVLWNGAFIVINFVYFSVQFYLLRPIKFHKDIEEV 102
            SMWD+YL+HC KWRPINH+FFQVANIFFL++FLAPHT  G IW+RVGL++GCAF G+W WSVECYLDAVLWN  FI+INFVYFS QFYL+RPIKFHK+IEEV
Sbjct:   68 SMWDLYLHHCSKWRPINHIFFQVANIFFLMSFLAPHTDIGQIWLRVGLMMGCAFSGMWAWSVECYLDAVLWNSVFILINFVYFSYQFYLMRPIKFHKEIEEV 169          
BLAST of OSCA026103-RA vs. genbank:protein
Match: gi|914561651|gb|KOB68292.1| (Blood vessel epicardial substance-like protein, partial [Operophtera brumata])

HSP 1 Score: 174.096 bits (440), Expect = 1.133e-53
Identity = 76/102 (74.51%), Postives = 91/102 (89.22%), Query Frame = 0
Query:    1 SMWDMYLNHCPKWRPINHVFFQVANIFFLLAFLAPHTPSGLIWMRVGLVLGCAFLGVWGWSVECYLDAVLWNGAFIVINFVYFSVQFYLLRPIKFH-KDIEE 101
            SMWD+YL+HCPKWRPINHVFFQVAN+FFL +FLAPHT SGLIW+R  L++GCAF G+W  +VEC+LDAV+WN AF+ INFVYF+VQ YL+RPIKFH K+IEE
Sbjct:   63 SMWDLYLDHCPKWRPINHVFFQVANMFFLFSFLAPHTSSGLIWLRAALMVGCAFFGLWAMTVECFLDAVVWNSAFVAINFVYFAVQLYLMRPIKFHNKEIEE 164          
The following BLAST results are available for this feature:
BLAST of OSCA026103-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|913298579|ref|XP_013192900.1|9.737e-6286.27PREDICTED: blood vessel epicardial substance-like ... [more]
gi|357621046|gb|EHJ73019.1|6.662e-6185.29hypothetical protein KGM_02476 [Danaus plexippus][more]
gi|443429440|gb|AGC92724.1|7.017e-6182.35blood vessel epicardial substance-like protein [He... [more]
gi|930675975|gb|KPJ16205.1|1.971e-5877.88Blood vessel epicardial substance-B [Papilio macha... [more]
gi|909567805|ref|XP_013139328.1|2.109e-5780.39PREDICTED: blood vessel epicardial substance-like ... [more]
gi|943947648|ref|XP_014356931.1|2.432e-5780.39PREDICTED: blood vessel epicardial substance-like ... [more]
gi|910325815|ref|XP_013166038.1|4.601e-5678.43PREDICTED: blood vessel epicardial substance-like ... [more]
gi|930663653|gb|KPJ05157.1|6.388e-5678.43Blood vessel epicardial substance [Papilio xuthus][more]
gi|827556894|ref|XP_012549761.1|2.116e-5479.41PREDICTED: uncharacterized protein LOC101745580 is... [more]
gi|914561651|gb|KOB68292.1|1.133e-5374.51Blood vessel epicardial substance-like protein, pa... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0016021 integral component of membrane
cellular_component GO:0016020 membrane
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR12101:SF1BVEScoord: 10..102
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 35..40
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 41..62
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 63..67
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 1..14
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 15..34
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 91..109
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 68..90
NoneNo IPR availableTMHMMTMhelixcoord: 41..58
NoneNo IPR availableTMHMMTMhelixcoord: 15..34
NoneNo IPR availableTMHMMTMhelixcoord: 68..90
IPR006916Popeye proteinPANTHERPTHR12101POPEYE DOMAIN CONTAINING PROTEINcoord: 10..102

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_37902contignewscf_37902:4..333 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA026103-RAOSCA026103-RAOstrinia scapulalismRNAnewscf_37902 4..333 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA026103-PA ID=OSCA026103-PA|Name=OSCA026103-RA|organism=Ostrinia scapulalis|type=polypeptide|length=109bp
SMWDMYLNHCPKWRPINHVFFQVANIFFLLAFLAPHTPSGLIWMRVGLVL
GCAFLGVWGWSVECYLDAVLWNGAFIVINFVYFSVQFYLLRPIKFHKDIE
EVSAVHIFS
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: INTERPRO
TermDefinition
IPR006916Popeye_prot