OSCA026104-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA026104-RA
Unique NameOSCA026104-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length89
Homology
The following BLAST results are available for this feature:
BLAST of OSCA026104-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_25849contignewscf_25849:818..1087 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA026104-RAOSCA026104-RAOstrinia scapulalismRNAnewscf_25849 818..1087 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA026104-PA ID=OSCA026104-PA|Name=OSCA026104-RA|organism=Ostrinia scapulalis|type=polypeptide|length=89bp
MGRAYCTQNGRPMGQQGSEVEAAYRKTQRGTYTQRCVVGCRQSTMSSVHP
RWTDDIVKVAGRRRTQAATNRATWKALGEAYVQQWSYYS
back to top