OSCA026105-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA026105-RA
Unique NameOSCA026105-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length68
Homology
BLAST of OSCA026105-RA vs. genbank:protein
Match: gi|930658195|gb|KPJ00401.1| (hypothetical protein RR46_06991 [Papilio xuthus])

HSP 1 Score: 60.8474 bits (146), Expect = 6.948e-11
Identity = 32/52 (61.54%), Postives = 36/52 (69.23%), Query Frame = 0
Query:   15 ATRPPTRWTDDLVKVAGRTCMQAAQERSLWKRGGGGFCPAVDVIWL-KRTNE 65
              RPP RWTDDLV+VAG + MQ AQ RS W   GGG CPAV  +WL K+ NE
Sbjct:   21 VVRPPARWTDDLVRVAGASWMQVAQNRSSWL-SGGGLCPAVGDLWLRKKKNE 71          
BLAST of OSCA026105-RA vs. genbank:protein
Match: gi|134001323|gb|ABO45239.1| (reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 60.4622 bits (145), Expect = 3.974e-9
Identity = 28/36 (77.78%), Postives = 29/36 (80.56%), Query Frame = 0
Query:   17 RPPTRWTDDLVKVAGRTCMQAAQERSLWKRGGGGFC 52
            RPPTRWTDDLVKVAG T MQAAQ+RSLWK  G  F 
Sbjct:  455 RPPTRWTDDLVKVAGSTWMQAAQDRSLWKSLGEAFV 490          
BLAST of OSCA026105-RA vs. genbank:protein
Match: gi|134001215|gb|ABO45231.1| (reverse transcriptase [Ostrinia nubilalis] >gi|134001296|gb|ABO45237.1| reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 60.4622 bits (145), Expect = 4.290e-9
Identity = 28/36 (77.78%), Postives = 29/36 (80.56%), Query Frame = 0
Query:   17 RPPTRWTDDLVKVAGRTCMQAAQERSLWKRGGGGFC 52
            RPPTRWTDDLVKVAG T MQAAQ+RSLWK  G  F 
Sbjct:  436 RPPTRWTDDLVKVAGSTWMQAAQDRSLWKSLGEAFV 471          
BLAST of OSCA026105-RA vs. genbank:protein
Match: gi|134001247|gb|ABO45233.1| (reverse transcriptase [Ostrinia nubilalis] >gi|134001274|gb|ABO45235.1| reverse transcriptase [Ostrinia nubilalis])

HSP 1 Score: 60.077 bits (144), Expect = 5.237e-9
Identity = 28/36 (77.78%), Postives = 29/36 (80.56%), Query Frame = 0
Query:   17 RPPTRWTDDLVKVAGRTCMQAAQERSLWKRGGGGFC 52
            RPPTRWTDDLVKVAG T MQAAQ+RSLWK  G  F 
Sbjct:  321 RPPTRWTDDLVKVAGSTWMQAAQDRSLWKSLGEAFV 356          
The following BLAST results are available for this feature:
BLAST of OSCA026105-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 4
Match NameE-valueIdentityDescription
gi|930658195|gb|KPJ00401.1|6.948e-1161.54hypothetical protein RR46_06991 [Papilio xuthus][more]
gi|134001323|gb|ABO45239.1|3.974e-977.78reverse transcriptase [Ostrinia nubilalis][more]
gi|134001215|gb|ABO45231.1|4.290e-977.78reverse transcriptase [Ostrinia nubilalis] >gi|134... [more]
gi|134001247|gb|ABO45233.1|5.237e-977.78reverse transcriptase [Ostrinia nubilalis] >gi|134... [more]
back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006278 RNA-dependent DNA biosynthetic process
molecular_function GO:0003964 RNA-directed DNA polymerase activity
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_42575contignewscf_42575:264..470 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA026105-RAOSCA026105-RAOstrinia scapulalismRNAnewscf_42575 264..470 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA026105-PA ID=OSCA026105-PA|Name=OSCA026105-RA|organism=Ostrinia scapulalis|type=polypeptide|length=68bp
NFSSGDLGLEDIARATRPPTRWTDDLVKVAGRTCMQAAQERSLWKRGGGG
FCPAVDVIWLKRTNELNE
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006278RNA-dependent DNA biosynthetic process
Vocabulary: Molecular Function
TermDefinition
GO:0003964RNA-directed DNA polymerase activity