OSCA026106-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA026106-RA
Unique NameOSCA026106-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length55
Homology
BLAST of OSCA026106-RA vs. genbank:protein
Match: gi|209395374|gb|ACI45413.1| (trypsin-like serine proteinase T21 [Ostrinia nubilalis])

HSP 1 Score: 111.694 bits (278), Expect = 4.318e-29
Identity = 53/55 (96.36%), Postives = 55/55 (100.00%), Query Frame = 0
Query:    1 STADACVGDGGGPVYFGNIIIGVISWGNGCLQEGFPGVNTAVSPYTPWIVATTSS 55
            STADACVGDGGGPVYFGNII+GVISWGNGCLQ+GFPGVNTAVSPYTPWIVATTSS
Sbjct:  202 STADACVGDGGGPVYFGNIIVGVISWGNGCLQDGFPGVNTAVSPYTPWIVATTSS 256          
BLAST of OSCA026106-RA vs. genbank:protein
Match: gi|8347660|gb|AAF74744.1|AF261982_1 (trypsin precursor Hz1, partial [Helicoverpa zea])

HSP 1 Score: 78.5666 bits (192), Expect = 1.094e-16
Identity = 34/50 (68.00%), Postives = 43/50 (86.00%), Query Frame = 0
Query:    3 ADACVGDGGGPVYFGNIIIGVISWGNGCLQEGFPGVNTAVSPYTPWIVAT 52
             DAC GD GGP+YFG+I++GV+SWG+GC  E FPGV+TAVSPYT WI++T
Sbjct:  146 KDACQGDSGGPLYFGDILVGVVSWGHGCANETFPGVSTAVSPYTNWILST 195          
BLAST of OSCA026106-RA vs. genbank:protein
Match: gi|237700844|gb|ACR16004.1| (serine protease 2 [Mamestra configurata])

HSP 1 Score: 79.337 bits (194), Expect = 1.598e-16
Identity = 35/51 (68.63%), Postives = 42/51 (82.35%), Query Frame = 0
Query:    4 DACVGDGGGPVYFGNIIIGVISWGNGCLQEGFPGVNTAVSPYTPWIVATTS 54
            DAC GD GGP+YFG+I++GV+SWG+GC    FPGV+TAVSPYT WI AT S
Sbjct:  211 DACQGDSGGPLYFGDILVGVVSWGHGCANATFPGVSTAVSPYTNWIAATVS 261          
BLAST of OSCA026106-RA vs. genbank:protein
Match: gi|909555513|ref|XP_013149268.1| (PREDICTED: transmembrane protease serine 9-like [Papilio polytes])

HSP 1 Score: 79.337 bits (194), Expect = 4.809e-16
Identity = 35/51 (68.63%), Postives = 42/51 (82.35%), Query Frame = 0
Query:    4 DACVGDGGGPVYFGNIIIGVISWGNGCLQEGFPGVNTAVSPYTPWIVATTS 54
            DAC GD GGP+YFG II+GV+SWG GC  + FPGV+TAVSPYT WI+AT +
Sbjct:  458 DACQGDSGGPLYFGEIIVGVVSWGEGCANDTFPGVSTAVSPYTDWILATAA 508          

HSP 2 Score: 62.003 bits (149), Expect = 6.357e-10
Identity = 28/49 (57.14%), Postives = 36/49 (73.47%), Query Frame = 0
Query:    4 DACVGDGGGPVYFGNIIIGVISWGNGCLQEGFPGVNTAVSPYTPWIVAT 52
            DAC GD GGP+Y+G I++G IS+G GC    FPGV  +++ YT WIVAT
Sbjct:  211 DACNGDSGGPMYYGQILVGTISFGIGCANATFPGVVASIASYTDWIVAT 259          
BLAST of OSCA026106-RA vs. genbank:protein
Match: gi|2853013|gb|AAC02216.1| (putative trypsin, partial [Helicoverpa armigera])

HSP 1 Score: 76.6406 bits (187), Expect = 5.282e-16
Identity = 33/53 (62.26%), Postives = 41/53 (77.36%), Query Frame = 0
Query:    3 ADACVGDGGGPVYFGNIIIGVISWGNGCLQEGFPGVNTAVSPYTPWIVATTSS 55
             DAC GD GGP+Y+GN+ +GV+SWG+GC    FPGV+TAVSPYT WI+ T  S
Sbjct:  145 KDACQGDSGGPLYYGNVTVGVVSWGHGCANATFPGVSTAVSPYTNWIIQTARS 197          
BLAST of OSCA026106-RA vs. genbank:protein
Match: gi|146327866|emb|CAM84320.1| (trypsinogen-like protein 1 [Manduca sexta])

HSP 1 Score: 77.7962 bits (190), Expect = 5.562e-16
Identity = 32/49 (65.31%), Postives = 42/49 (85.71%), Query Frame = 0
Query:    4 DACVGDGGGPVYFGNIIIGVISWGNGCLQEGFPGVNTAVSPYTPWIVAT 52
            DAC GD GGP+Y+GNII+G++SWG+GC  E FPG++TAV+PY+ WI AT
Sbjct:  223 DACQGDSGGPLYYGNIIVGIVSWGHGCANETFPGLSTAVAPYSDWIAAT 271          
BLAST of OSCA026106-RA vs. genbank:protein
Match: gi|8347658|gb|AAF74743.1|AF261981_1 (trypsin precursor Hz8, partial [Helicoverpa zea])

HSP 1 Score: 75.0998 bits (183), Expect = 2.818e-15
Identity = 32/49 (65.31%), Postives = 40/49 (81.63%), Query Frame = 0
Query:    4 DACVGDGGGPVYFGNIIIGVISWGNGCLQEGFPGVNTAVSPYTPWIVAT 52
            DAC GD GGP+Y+GN+ +GV+SWG+GC    FPGV+TAVSPYT WI+ T
Sbjct:  161 DACQGDSGGPLYYGNVTVGVVSWGHGCANATFPGVSTAVSPYTDWIIQT 209          
BLAST of OSCA026106-RA vs. genbank:protein
Match: gi|156968305|gb|ABU98624.1| (protease [Helicoverpa armigera])

HSP 1 Score: 75.0998 bits (183), Expect = 5.116e-15
Identity = 32/50 (64.00%), Postives = 40/50 (80.00%), Query Frame = 0
Query:    3 ADACVGDGGGPVYFGNIIIGVISWGNGCLQEGFPGVNTAVSPYTPWIVAT 52
             DAC GD GGP+Y+GN+ +GV+SWG+GC    FPGV+TAVSPYT WI+ T
Sbjct:  209 KDACQGDSGGPLYYGNVTVGVVSWGHGCANATFPGVSTAVSPYTDWIIQT 258          
BLAST of OSCA026106-RA vs. genbank:protein
Match: gi|38455223|gb|AAR20817.1| (putative midgut trypsin, partial [Helicoverpa armigera])

HSP 1 Score: 72.7886 bits (177), Expect = 1.115e-14
Identity = 31/48 (64.58%), Postives = 39/48 (81.25%), Query Frame = 0
Query:    3 ADACVGDGGGPVYFGNIIIGVISWGNGCLQEGFPGVNTAVSPYTPWIV 50
             DAC GD GGP+Y+GN+ +GV+SWG+GC    FPGV+TAVSPYT WI+
Sbjct:  123 KDACQGDSGGPLYYGNVTVGVVSWGHGCANATFPGVSTAVSPYTNWII 170          
BLAST of OSCA026106-RA vs. genbank:protein
Match: gi|51094350|gb|AAT95343.1| (trypsin Ib2, partial [Sesamia nonagrioides])

HSP 1 Score: 73.559 bits (179), Expect = 1.261e-14
Identity = 30/48 (62.50%), Postives = 41/48 (85.42%), Query Frame = 0
Query:    4 DACVGDGGGPVYFGNIIIGVISWGNGCLQEGFPGVNTAVSPYTPWIVA 51
            DAC GD GGP+Y+ NI++G++SWG+GC +E +PGV+TAVS YT WIV+
Sbjct:  170 DACQGDSGGPLYYDNILVGIVSWGHGCAREHYPGVSTAVSSYTDWIVS 217          
The following BLAST results are available for this feature:
BLAST of OSCA026106-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|209395374|gb|ACI45413.1|4.318e-2996.36trypsin-like serine proteinase T21 [Ostrinia nubil... [more]
gi|8347660|gb|AAF74744.1|AF261982_11.094e-1668.00trypsin precursor Hz1, partial [Helicoverpa zea][more]
gi|237700844|gb|ACR16004.1|1.598e-1668.63serine protease 2 [Mamestra configurata][more]
gi|909555513|ref|XP_013149268.1|4.809e-1668.63PREDICTED: transmembrane protease serine 9-like [P... [more]
gi|2853013|gb|AAC02216.1|5.282e-1662.26putative trypsin, partial [Helicoverpa armigera][more]
gi|146327866|emb|CAM84320.1|5.562e-1665.31trypsinogen-like protein 1 [Manduca sexta][more]
gi|8347658|gb|AAF74743.1|AF261981_12.818e-1565.31trypsin precursor Hz8, partial [Helicoverpa zea][more]
gi|156968305|gb|ABU98624.1|5.116e-1564.00protease [Helicoverpa armigera][more]
gi|38455223|gb|AAR20817.1|1.115e-1464.58putative midgut trypsin, partial [Helicoverpa armi... [more]
gi|51094350|gb|AAT95343.1|1.261e-1462.50trypsin Ib2, partial [Sesamia nonagrioides][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006508 proteolysis
molecular_function GO:0004252 serine-type endopeptidase activity
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001254Peptidase S1PFAMPF00089Trypsincoord: 3..49
e-value: 2.9E-11
score: 43.2
IPR001254Peptidase S1PROSITEPS50240TRYPSIN_DOMcoord: 1..54
score: 9.893
NoneNo IPR availableGENE3D2.40.10.10coord: 3..54
e-value: 9.1E-16
score: 57.7
IPR009003Trypsin-like cysteine/serine peptidase domainSUPERFAMILY50494Trypsin-like serine proteasescoord: 3..54

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_49564contignewscf_49564:4..171 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA026106-RAOSCA026106-RAOstrinia scapulalismRNAnewscf_49564 4..171 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA026106-PA ID=OSCA026106-PA|Name=OSCA026106-RA|organism=Ostrinia scapulalis|type=polypeptide|length=55bp
STADACVGDGGGPVYFGNIIIGVISWGNGCLQEGFPGVNTAVSPYTPWIV
ATTSS
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006508proteolysis
Vocabulary: Molecular Function
TermDefinition
GO:0004252serine-type endopeptidase activity
Vocabulary: INTERPRO
TermDefinition
IPR009003Trypsin-like_Pept_dom
IPR001254Peptidase_S1