OSCA026107-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA026107-RA
Unique NameOSCA026107-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length87
Homology
BLAST of OSCA026107-RA vs. genbank:protein
Match: gi|1048058989|ref|XP_017482896.1| (PREDICTED: uncharacterized mitochondrial protein AtMg00810-like [Rhagoletis zephyria])

HSP 1 Score: 112.079 bits (279), Expect = 7.947e-28
Identity = 49/77 (63.64%), Postives = 67/77 (87.01%), Query Frame = 0
Query:    6 YSKGNVKLVGFVDADWASDMLDRKSYTGFCFVMSGSVISWQSRKQRTVALSSTEAEYMALSEAAREAIYLRNLIYEL 82
            Y K N+ L+G+ DADWA    DR+SYTG+ F++SG+VISW+S+KQRTVALSSTEAEY++L+EAA+EA+YLR+L+ E+
Sbjct:  178 YQKSNLPLIGYTDADWAGCTTDRRSYTGYAFLLSGAVISWKSQKQRTVALSSTEAEYVSLAEAAKEAVYLRSLLNEI 254          
BLAST of OSCA026107-RA vs. genbank:protein
Match: gi|618009562|gb|JAC39601.1| (Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Bactrocera dorsalis])

HSP 1 Score: 112.849 bits (281), Expect = 2.835e-27
Identity = 49/79 (62.03%), Postives = 67/79 (84.81%), Query Frame = 0
Query:    4 LKYSKGNVKLVGFVDADWASDMLDRKSYTGFCFVMSGSVISWQSRKQRTVALSSTEAEYMALSEAAREAIYLRNLIYEL 82
            L+YS     + GFVDADW +DM+DRKS++G+ FV+SGS I+WQS+KQ+TVALSSTEAEY+AL+E  +EA++LRNL+ E+
Sbjct:  451 LRYSACGKPVQGFVDADWGNDMMDRKSFSGYAFVLSGSAITWQSKKQQTVALSSTEAEYVALAEGVKEALFLRNLLNEI 529          
BLAST of OSCA026107-RA vs. genbank:protein
Match: gi|861626514|gb|KMQ88817.1| (gag-pol polyprotein [Lasius niger])

HSP 1 Score: 109.383 bits (272), Expect = 2.975e-27
Identity = 48/81 (59.26%), Postives = 66/81 (81.48%), Query Frame = 0
Query:    2 YHLKYSKGNVKLVGFVDADWASDMLDRKSYTGFCFVMSGSVISWQSRKQRTVALSSTEAEYMALSEAAREAIYLRNLIYEL 82
            Y L Y+K  V L+GFVDADW  ++ DR SYTGF F ++ + I+W++RKQ+++ALSSTEAEYMAL+EAA+E +YLRNL+ E+
Sbjct:  130 YGLVYTKMEVPLIGFVDADWGGNVDDRVSYTGFVFKLANAAITWEARKQKSIALSSTEAEYMALTEAAKETVYLRNLLEEM 210          
BLAST of OSCA026107-RA vs. genbank:protein
Match: gi|861626500|gb|KMQ88815.1| (gag-pol polyprotein [Lasius niger])

HSP 1 Score: 109.383 bits (272), Expect = 3.088e-27
Identity = 48/81 (59.26%), Postives = 66/81 (81.48%), Query Frame = 0
Query:    2 YHLKYSKGNVKLVGFVDADWASDMLDRKSYTGFCFVMSGSVISWQSRKQRTVALSSTEAEYMALSEAAREAIYLRNLIYEL 82
            Y L Y+K  V L+GFVDADW  ++ DR SYTGF F ++ + I+W++RKQ+++ALSSTEAEYMAL+EAA+E +YLRNL+ E+
Sbjct:  128 YGLVYTKMEVPLIGFVDADWGGNVDDRVSYTGFVFKLANAAITWEARKQKSIALSSTEAEYMALTEAAKETVYLRNLLEEM 208          
BLAST of OSCA026107-RA vs. genbank:protein
Match: gi|1009403089|gb|KYN22643.1| (Copia protein [Trachymyrmex cornetzi])

HSP 1 Score: 107.457 bits (267), Expect = 6.999e-27
Identity = 49/81 (60.49%), Postives = 64/81 (79.01%), Query Frame = 0
Query:    2 YHLKYSKGNVKLVGFVDADWASDMLDRKSYTGFCFVMSGSVISWQSRKQRTVALSSTEAEYMALSEAAREAIYLRNLIYEL 82
            Y L Y++ +  L+GF DADW S  LDR+SYTG  F++S + ISW+SRKQRTVALSSTEAEY+ALS+AA+EA+YL   + E+
Sbjct:   86 YGLHYTRSHKHLIGFTDADWGSCTLDRRSYTGAVFLLSNAAISWESRKQRTVALSSTEAEYIALSDAAKEAVYLSKFLSEI 166          
BLAST of OSCA026107-RA vs. genbank:protein
Match: gi|617998205|gb|JAC35909.1| (Copia protein, partial [Bactrocera dorsalis])

HSP 1 Score: 104.76 bits (260), Expect = 9.290e-27
Identity = 50/82 (60.98%), Postives = 63/82 (76.83%), Query Frame = 0
Query:    3 HLK--YSKGNVKLVGFVDADWASDMLDRKSYTGFCFVMSGSVISWQSRKQRTVALSSTEAEYMALSEAAREAIYLRNLIYEL 82
            HL+  Y K    + GF DADWA+D LDRKSY+G+ F++ GS+ SW S KQ  VALSSTEAEY+AL+ AA+EAIYLRNL+ E+
Sbjct:    2 HLRIVYRKVGEPVQGFADADWANDQLDRKSYSGYAFILGGSIFSWSSAKQSVVALSSTEAEYVALTAAAKEAIYLRNLLTEI 83          
BLAST of OSCA026107-RA vs. genbank:protein
Match: gi|930670667|gb|KPJ11482.1| (Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Papilio machaon])

HSP 1 Score: 110.538 bits (275), Expect = 2.507e-26
Identity = 49/83 (59.04%), Postives = 65/83 (78.31%), Query Frame = 0
Query:    2 YHLKYSKGNVKLVGFVDADWASDMLDRKSYTGFCFVMSGSVISWQSRKQRTVALSSTEAEYMALSEAAREAIYLRNLIYELTG 84
            Y + Y K ++ + G+VDADWAS+ LDR+SYTG+ F +  S +SW+SRKQRTVALSSTEAEYMAL E A+EA ++R+ +YE  G
Sbjct: 1156 YKIVYEKSSLCVTGYVDADWASNQLDRRSYTGYVFKIGNSAVSWESRKQRTVALSSTEAEYMALCEGAKEAQFIRSFVYECLG 1238          
BLAST of OSCA026107-RA vs. genbank:protein
Match: gi|861617084|gb|KMQ86503.1| (retrovirus-related pol polyprotein from transposon tnt 1-94 [Lasius niger])

HSP 1 Score: 104.76 bits (260), Expect = 2.758e-26
Identity = 51/79 (64.56%), Postives = 63/79 (79.75%), Query Frame = 0
Query:    4 LKYSKGNVKLVGFVDADWASDMLDRKSYTGFCFVMSGSVISWQSRKQRTVALSSTEAEYMALSEAAREAIYLRNLIYEL 82
            L + K +  L  +VDADWA+  LDR+SYTGF F +  S++SW+SRKQRTVALSSTEAEYMALSEAA+EAI LR+ + EL
Sbjct:   48 LNFPKRHGPLTTYVDADWANCPLDRRSYTGFTFQIGRSLVSWESRKQRTVALSSTEAEYMALSEAAKEAICLRSSLIEL 126          
BLAST of OSCA026107-RA vs. genbank:protein
Match: gi|861628967|gb|KMQ89607.1| (copia ltr rider [Lasius niger])

HSP 1 Score: 110.153 bits (274), Expect = 3.359e-26
Identity = 49/77 (63.64%), Postives = 63/77 (81.82%), Query Frame = 0
Query:    6 YSKGNVKLVGFVDADWASDMLDRKSYTGFCFVMSGSVISWQSRKQRTVALSSTEAEYMALSEAAREAIYLRNLIYEL 82
            Y KG  +L GF DADWA   LDR+SYTG+ F +SG+ ++W+SRKQRTVALSSTEAEYM+L+EA +EA+YLR L+ E+
Sbjct: 1213 YRKGCKELNGFTDADWAGCPLDRRSYTGYAFTLSGAAVNWESRKQRTVALSSTEAEYMSLTEATKEALYLRKLLKEI 1289          
BLAST of OSCA026107-RA vs. genbank:protein
Match: gi|1009402767|gb|KYN22388.1| (Copia protein [Trachymyrmex cornetzi])

HSP 1 Score: 105.916 bits (263), Expect = 4.033e-26
Identity = 47/79 (59.49%), Postives = 64/79 (81.01%), Query Frame = 0
Query:    4 LKYSKGNVKLVGFVDADWASDMLDRKSYTGFCFVMSGSVISWQSRKQRTVALSSTEAEYMALSEAAREAIYLRNLIYEL 82
            L + K    L+G+VDADWA+ + DRKSYTGF F+++G+ ++W+SRKQ T ALSSTEAEYMALSEA +EA+YL++ + EL
Sbjct:   87 LSFKKLKKPLIGYVDADWANCLDDRKSYTGFAFILAGNPVTWESRKQPTTALSSTEAEYMALSEATKEALYLQSFLMEL 165          
The following BLAST results are available for this feature:
BLAST of OSCA026107-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|1048058989|ref|XP_017482896.1|7.947e-2863.64PREDICTED: uncharacterized mitochondrial protein A... [more]
gi|618009562|gb|JAC39601.1|2.835e-2762.03Retrovirus-related Pol polyprotein from transposon... [more]
gi|861626514|gb|KMQ88817.1|2.975e-2759.26gag-pol polyprotein [Lasius niger][more]
gi|861626500|gb|KMQ88815.1|3.088e-2759.26gag-pol polyprotein [Lasius niger][more]
gi|1009403089|gb|KYN22643.1|6.999e-2760.49Copia protein [Trachymyrmex cornetzi][more]
gi|617998205|gb|JAC35909.1|9.290e-2760.98Copia protein, partial [Bactrocera dorsalis][more]
gi|930670667|gb|KPJ11482.1|2.507e-2659.04Retrovirus-related Pol polyprotein from transposon... [more]
gi|861617084|gb|KMQ86503.1|2.758e-2664.56retrovirus-related pol polyprotein from transposon... [more]
gi|861628967|gb|KMQ89607.1|3.359e-2663.64copia ltr rider [Lasius niger][more]
gi|1009402767|gb|KYN22388.1|4.033e-2659.49Copia protein [Trachymyrmex cornetzi][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0015074 DNA integration
molecular_function GO:0003676 nucleic acid binding
molecular_function GO:0008270 zinc ion binding
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR11439:SF127TRANSPOSON TY4-H GAG POLYPROTEIN-RELATEDcoord: 2..82
NoneNo IPR availablePANTHERPTHR11439GAG-POL-RELATED RETROTRANSPOSONcoord: 2..82

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_9933contignewscf_9933:9906..10166 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA026107-RAOSCA026107-RAOstrinia scapulalismRNAnewscf_9933 9906..10166 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA026107-PA ID=OSCA026107-PA|Name=OSCA026107-RA|organism=Ostrinia scapulalis|type=polypeptide|length=87bp
MYHLKYSKGNVKLVGFVDADWASDMLDRKSYTGFCFVMSGSVISWQSRKQ
RTVALSSTEAEYMALSEAAREAIYLRNLIYELTGKLD
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0015074DNA integration
Vocabulary: Molecular Function
TermDefinition
GO:0008270zinc ion binding
GO:0003676nucleic acid binding