OSCA026109-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA026109-RA
Unique NameOSCA026109-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length227
Homology
BLAST of OSCA026109-RA vs. genbank:protein
Match: gi|914568265|gb|KOB72263.1| (Uncharacterized protein OBRU01_12558 [Operophtera brumata])

HSP 1 Score: 254.603 bits (649), Expect = 2.647e-78
Identity = 120/210 (57.14%), Postives = 160/210 (76.19%), Query Frame = 0
Query:    2 LTQKVLQSWDEIGFKTVEDLNYNNVLGSGIFRVTAFNGRRGSTDHVYLNPARSRKNLFVITNALVTKVLINSNTLEANGVEVERDGKLMNVFAKSKVILSAGTVNTPQLLMLSRIGPKEHLESKNIRCLVNLPAVGKYLQDHLMIPVTIYGDGDSEPSQAEKSFDSVQYVYNKMGSLAQNSLSDVVSFYSRKQRAGYPEFQNHLKIFHKN 211
            +T+ V+ SWDEIG K V+DLN  NVLGSGI  VTA NG R S+   Y+NP + R NL ++ N L TKVLI++ T +A GV+V+R+G+ M   A+ +VILSAG VN+PQLLMLS +GPK+HLESKNI C V++P VG+ LQDH++IPVTIYG G ++P  A  +FD+++Y++N+ G LAQNS SD+++FYS  + A YPEFQ+HL IF KN
Sbjct:  169 ITESVIDSWDEIGIKRVDDLNTANVLGSGICTVTAANGIRQSSVAAYINPVQDRPNLKILKNTLCTKVLIDAGTKKAIGVKVKRNGQTMTFIARLEVILSAGAVNSPQLLMLSGVGPKKHLESKNITCKVDVPMVGQNLQDHVIIPVTIYGHGPTQPDTATTNFDAIRYLFNRTGYLAQNSFSDILAFYSTAKNASYPEFQSHLSIFWKN 378          
BLAST of OSCA026109-RA vs. genbank:protein
Match: gi|768421339|ref|XP_011551476.1| (PREDICTED: glucose dehydrogenase [FAD, quinone]-like [Plutella xylostella])

HSP 1 Score: 253.832 bits (647), Expect = 1.612e-77
Identity = 124/226 (54.87%), Postives = 161/226 (71.24%), Query Frame = 0
Query:    1 SLTQKVLQSWDEIGFKTVEDLNYNNVLGSGIFRVTAFNGRRGSTDHVYLNPARSRKNLFVITNALVTKVLINSNTLEANGVEVERDGKLMNVFAKSKVILSAGTVNTPQLLMLSRIGPKEHLESKNIRCLVNLPAVGKYLQDHLMIPVTIYGDGDSEPSQAEKSFDSVQYVYNKMGSLAQNSLSDVVSFYSRKQRAGYPEFQNHLKIFHKNSSDLQDYLNKTVGYK 226
            SLT KVL +WDEIGFKTV+DLN  NV+GSGIFRVTA  GRR  T   YL   ++RKNL ++ N LVTKV+IN  + E  G+EVE  G +   FAK +V+LSAG +NTPQ+LM+S IGP +HL SKNI  +VN PAVG++L+DH+++PVTIYG    + S A + F  ++Y+YN+ G LAQ S  D+ +FYS +Q + YP+FQ+HL IF KNSS+   Y N    YK
Sbjct:  210 SLTDKVLSAWDEIGFKTVKDLNAANVMGSGIFRVTATGGRREDTATAYLINIQNRKNLKILKNTLVTKVIINKYSKETLGIEVEHKGNIQKYFAKKEVVLSAGAINTPQILMISGIGPGDHLLSKNIDTIVNSPAVGQHLKDHVIVPVTIYGQDHGQESTASRHFQEIEYLYNRTGYLAQVSFKDISAFYSLRQDSEYPDFQSHLNIFFKNSSNTLKYFNNIARYK 435          
BLAST of OSCA026109-RA vs. genbank:protein
Match: gi|943971889|ref|XP_014367484.1| (PREDICTED: glucose dehydrogenase [FAD, quinone]-like [Papilio machaon])

HSP 1 Score: 217.238 bits (552), Expect = 3.772e-64
Identity = 112/227 (49.34%), Postives = 159/227 (70.04%), Query Frame = 0
Query:    1 SLTQKVLQSWDEIGFKTVEDLNYNNVLGSGIFRVTAFNGRRGSTDHVYLNPARSRKNLFVITNALVTKVLINSNTLEANGVEVERDGKLMNVFAKSKVILSAGTVNTPQLLMLSRIGPKEHLESKNIRCLVNLPAVGKYLQDHLMIPVTIYGDGDSEPSQAEKSFDSVQYVYNKMGSLAQNSLSDVVSFYSRKQRAGYPEFQNHLKIFHKNSSDLQDYLNKTVGYKE 227
            +LT KVL S+DE+GFK  EDL    +LGSGIFR TA+NGRR ST   YL+  ++RKN  +  NALV KVLI++N   A GV V++ GK + +FA+ ++ILSAGT+N+PQLLMLS IG K HLE+K I+C V+LP VGK LQDHL++ + ++ +     +  EK  D   Y YN+ GS AQ S++D+++F+++ + A  P+FQ+HL IF KNS+  +++ +    YKE
Sbjct:  137 NLTLKVLSSYDEMGFKIREDLQTAQLLGSGIFRATAYNGRRASTATTYLSYIQNRKNFKLFKNALVLKVLIDNNN-RAYGVLVKQKGKTIKIFARFEIILSAGTINSPQLLMLSGIGEKNHLEAKRIKCKVDLPGVGKNLQDHLILTIPVFSNEPGYENIEEKYLDVALYAYNRTGSWAQTSIADILAFFAKGKNALIPDFQSHLVIFPKNSTRAKNFFSI---YKE 359          
BLAST of OSCA026109-RA vs. genbank:protein
Match: gi|930667156|gb|KPJ08244.1| (Glucose dehydrogenase [acceptor] [Papilio machaon])

HSP 1 Score: 216.853 bits (551), Expect = 6.181e-62
Identity = 109/220 (49.55%), Postives = 156/220 (70.91%), Query Frame = 0
Query:    1 SLTQKVLQSWDEIGFKTVEDLNYNNVLGSGIFRVTAFNGRRGSTDHVYLNPARSRKNLFVITNALVTKVLINSNTLEANGVEVERDGKLMNVFAKSKVILSAGTVNTPQLLMLSRIGPKEHLESKNIRCLVNLPAVGKYLQDHLMIPVTIYGDGDSEPSQAEKSFDSVQYVYNKMGSLAQNSLSDVVSFYSRKQRAGYPEFQNHLKIFHKNSSDLQDYLN 220
            +LT KVL S+DE+GFK  EDL    +LGSGIFR TA+NGRR ST   YL+  ++RKN  +  NALV KVLI++N   A GV V++ GK + +FA+ ++ILSAGT+N+PQLLMLS IG K HLE+K I+C V+LP VGK LQDHL++ + ++ +     +  EK  D   Y YN+ GS AQ S++D+++F+++ + A  P+FQ+HL IF KNS+  +++ +
Sbjct:   69 NLTLKVLSSYDEMGFKIREDLQTAQLLGSGIFRATAYNGRRASTATTYLSYIQNRKNFKLFKNALVLKVLIDNNN-RAYGVLVKQKGKTIKIFARFEIILSAGTINSPQLLMLSGIGEKNHLEAKRIKCKVDLPGVGKNLQDHLILTIPVFSNEPGYENIEEKYLDVALYAYNRTGSWAQTSIADILAFFAKGKNALIPDFQSHLVIFPKNSTRAKNFFS 287          

HSP 2 Score: 134.42 bits (337), Expect = 1.694e-32
Identity = 74/160 (46.25%), Postives = 108/160 (67.50%), Query Frame = 0
Query:    2 LTQKVLQSWDEIGFKTVEDLNYNNVLGSGIFRVTAFNGRRGSTDHVYLNPARSRKNLFVITNALVTKVLINSNTLEANGVEVERDGKLMNVFAKSKVILSAGTVNTPQLLMLSRIGPKEHLESKNIRCLVNLPAVGKYLQDHLMIPVTIYGDGDSEPSQA 161
            L + +L+S+++IG +  EDL+  N+LG+G+ R TA+NG R ST   YL+  + R+N  +I NA V K+L++SN+ +A GV V+  GK + VFA  +VI+SAG++N+PQLLMLS IG K+HLESK+I C V+LP V   +   +  PV     G  +PS A
Sbjct:  634 LVKNLLESYNQIGLQKQEDLHLANLLGAGLSRDTAYNGIRASTATTYLSQIQHRENFKLIKNAFVVKILLDSNS-KAYGVVVKYRGKEIKVFASEEVIISAGSINSPQLLMLSGIGEKKHLESKDIACKVDLPGVAPEIVTTIYHPVGTCAMG-PDPSSA 791          
BLAST of OSCA026109-RA vs. genbank:protein
Match: gi|930660712|gb|KPJ02687.1| (Glucose dehydrogenase [acceptor] [Papilio xuthus])

HSP 1 Score: 212.616 bits (540), Expect = 1.803e-61
Identity = 110/227 (48.46%), Postives = 159/227 (70.04%), Query Frame = 0
Query:    1 SLTQKVLQSWDEIGFKTVEDLNYNNVLGSGIFRVTAFNGRRGSTDHVYLNPARSRKNLFVITNALVTKVLINSNTLEANGVEVERDGKLMNVFAKSKVILSAGTVNTPQLLMLSRIGPKEHLESKNIRCLVNLPAVGKYLQDHLMIPVTIYGDGDSEPSQAEKSFDSVQYVYNKMGSLAQNSLSDVVSFYSRKQRAGYPEFQNHLKIFHKNSSDLQDYLNKTVGYKE 227
            +LT  VL S++E+GFK  EDL    +LGSGIFR TA+NGRR ST   YL+  ++R N  +I N LV KVLI++N   A GV +++ GK+M +FA+ +VILSAGT+N+PQLLMLS IG K HLE+K I+C V+LPAVGK LQDH+++ V ++ +     +  EK  D   Y YN+ GSLAQ  ++D+++F+++ + A  P++Q+HL IF +NS+  ++Y +    YKE
Sbjct:  245 NLTLNVLSSYNEMGFKIREDLQTAQLLGSGIFRATAYNGRRASTASTYLSYIQNRTNFKLIKNTLVLKVLIDNNQ-RAYGVLLKQKGKIMKIFARLEVILSAGTINSPQLLMLSGIGEKNHLEAKRIQCKVDLPAVGKNLQDHMILTVPVFSNYPGYENIDEKYLDVALYAYNRSGSLAQARIADILAFFAKDKNALIPDYQSHLIIFPRNSTQAKNYFSI---YKE 467          
BLAST of OSCA026109-RA vs. genbank:protein
Match: gi|910331533|ref|XP_013169097.1| (PREDICTED: glucose dehydrogenase [FAD, quinone]-like [Papilio xuthus])

HSP 1 Score: 211.46 bits (537), Expect = 2.469e-61
Identity = 109/227 (48.02%), Postives = 158/227 (69.60%), Query Frame = 0
Query:    1 SLTQKVLQSWDEIGFKTVEDLNYNNVLGSGIFRVTAFNGRRGSTDHVYLNPARSRKNLFVITNALVTKVLINSNTLEANGVEVERDGKLMNVFAKSKVILSAGTVNTPQLLMLSRIGPKEHLESKNIRCLVNLPAVGKYLQDHLMIPVTIYGDGDSEPSQAEKSFDSVQYVYNKMGSLAQNSLSDVVSFYSRKQRAGYPEFQNHLKIFHKNSSDLQDYLNKTVGYKE 227
            +LT  VL S++E+GFK  EDL    +LGSGIFR TA+NGRR ST   YL+  ++R N  +I N LV KVLI++N   A GV +++ GK+M +FA+ +VILSAGT+N+PQLLMLS IG K HLE+K I+C V+LPAVGK LQDH+++ V ++ +     +  EK  D   Y YN+ GS AQ  ++D+++F+++ + A  P++Q+HL IF +NS+  ++Y +    YKE
Sbjct:  215 NLTLNVLSSYNEMGFKIREDLQTAQLLGSGIFRATAYNGRRASTASTYLSYIQNRTNFKLIKNTLVLKVLIDNNQ-RAYGVLLKQKGKIMKIFARLEVILSAGTINSPQLLMLSGIGEKNHLEAKRIQCKVDLPAVGKNLQDHMILTVPVFSNYPGYENTDEKYLDVALYAYNRTGSWAQARIADILAFFAKDKNALIPDYQSHLIIFPRNSTQAKNYFSI---YKE 437          
BLAST of OSCA026109-RA vs. genbank:protein
Match: gi|512887536|ref|XP_004921941.1| (PREDICTED: glucose dehydrogenase [FAD, quinone]-like isoform X1 [Bombyx mori])

HSP 1 Score: 203.756 bits (517), Expect = 2.126e-58
Identity = 106/227 (46.70%), Postives = 150/227 (66.08%), Query Frame = 0
Query:    2 LTQKVLQSWDEIGFKTVEDLNYNNVLGSGIFRVTAFNGRRGSTDHVYLNPARSRKNLFVITNALVTKVLINSNTLEANGVEVERDGKLMNVFAKSKVILSAGTVNTPQLLMLSRIGPKEHLESKNIRCLVNLPAVGKYLQDHLMIPVTIYGD-GDSEPSQAEKSFDSVQYVYNKMGSLAQNSLSDVVSFYSRKQRAGYPEFQNHLKIFHKNSSDLQDYLNKTVGYKE 227
            L + V+ S+DEI F+   D++  N  GSG F++   NGRR ST   YLN  + RKNL +ITNA VTK+LI+S T    GVEVE  G+    +A  +VILSAGT+NTPQ+LM+S IGP++ L SK I C V+ P VGK LQDH ++PVT+YGD    + S+AE++FD ++Y+YN+ G LA  S   + + Y+      YP+FQ+ L ++ KN+S +++   K  GYK+
Sbjct:  211 LIESVINSFDEISFRRNCDISALNAFGSGKFKINGSNGRRVSTAKAYLNTIQKRKNLKIITNAFVTKILIDSVTKTVEGVEVEVQGQKKTFYANLEVILSAGTINTPQILMISGIGPEDQLSSKGISCKVDSPMVGKNLQDHAIVPVTVYGDKPKKKKSEAERNFDIIRYLYNRSGPLAYISSPGIAALYTDDPNLPYPKFQSFLILYEKNTSSVREAFEKR-GYKQ 436          
BLAST of OSCA026109-RA vs. genbank:protein
Match: gi|930660714|gb|KPJ02689.1| (Glucose dehydrogenase [acceptor] [Papilio xuthus])

HSP 1 Score: 197.593 bits (501), Expect = 5.152e-56
Identity = 102/210 (48.57%), Postives = 144/210 (68.57%), Query Frame = 0
Query:    4 QKVLQSWDEIGFKTVEDLNYNNVLGSGIFRVTAFNGRRGSTDHVYLNPARSRKNLFVITNALVTKVLINSNTLEANGVEVERDGKLMNVFAKSKVILSAGTVNTPQLLMLSRIGPKEHLESKNIRCLVNLPAVGKYLQDHLMIPVTIYGDGDSEPSQAEKSFDSVQYVYNKMGSLAQNSLSDVVSFYSRKQRAGYPEFQNHLKIFHKNSS 213
            + V  S+++IG +  EDL   N+LG+G+ R TA+NGRR ST   YL+  + R+N  ++ NA V K+L++ N+ +A GV V+  G+ + VFA ++VI+SAG++N+PQLLMLS IG K+HLESKNI C V+LP VGK LQDH++I V ++G      +  +K  D  +Y YN+ G LA +S   V++FYSR + A YPEFQ HL I  KNSS
Sbjct:  219 ENVFNSFNQIGLQIQEDLQLANLLGAGLSRDTAYNGRRASTATTYLSQIQHRENFKLMKNAFVVKILLDDNS-KAYGVVVKYKGEEIKVFASNEVIISAGSINSPQLLMLSGIGEKKHLESKNIDCKVDLPGVGKNLQDHIIINVPVFGRKSRSENYIDKYLDVGRYTYNRTGYLAHSSAPHVIAFYSRNKNATYPEFQVHLDIADKNSS 427          
BLAST of OSCA026109-RA vs. genbank:protein
Match: gi|910331562|ref|XP_013169112.1| (PREDICTED: glucose dehydrogenase [FAD, quinone]-like [Papilio xuthus])

HSP 1 Score: 196.823 bits (499), Expect = 8.637e-56
Identity = 101/210 (48.10%), Postives = 143/210 (68.10%), Query Frame = 0
Query:    4 QKVLQSWDEIGFKTVEDLNYNNVLGSGIFRVTAFNGRRGSTDHVYLNPARSRKNLFVITNALVTKVLINSNTLEANGVEVERDGKLMNVFAKSKVILSAGTVNTPQLLMLSRIGPKEHLESKNIRCLVNLPAVGKYLQDHLMIPVTIYGDGDSEPSQAEKSFDSVQYVYNKMGSLAQNSLSDVVSFYSRKQRAGYPEFQNHLKIFHKNSS 213
            + V  S+++IG +  EDL   N+LG+G+ R TA+NGRR ST   YL+  + R+N  ++ NA V K+L++  + +A GV V+  G+ + VFA ++VI+SAG++N+PQLLMLS IG K+HLESKNI C V+LP VGK LQDH++I V ++G      +  +K  D  +Y YN+ G LA +S   V++FYSR + A YPEFQ HL I  KNSS
Sbjct:  222 ENVFNSFNQIGLQIQEDLQLANLLGAGLSRDTAYNGRRASTATTYLSQIQHRENFKIMKNAFVVKILLDDKS-KAYGVVVKYKGEEIKVFASNEVIISAGSINSPQLLMLSGIGEKKHLESKNIDCKVDLPGVGKNLQDHIIINVPVFGRKPRSENYIDKYLDVARYTYNRTGYLAHSSAPHVIAFYSRNKNATYPEFQVHLDIADKNSS 430          
BLAST of OSCA026109-RA vs. genbank:protein
Match: gi|910331315|ref|XP_013168980.1| (PREDICTED: glucose dehydrogenase [FAD, quinone]-like [Papilio xuthus])

HSP 1 Score: 195.667 bits (496), Expect = 2.664e-55
Identity = 100/217 (46.08%), Postives = 147/217 (67.74%), Query Frame = 0
Query:    4 QKVLQSWDEIGFKTVEDLNYNNVLGSGIFRVTAFNGRRGSTDHVYLNPARSRKNLFVITNALVTKVLINSNTLEANGVEVERDGKLMNVFAKSKVILSAGTVNTPQLLMLSRIGPKEHLESKNIRCLVNLPAVGKYLQDHLMIPVTIYGDGDSEPSQAEKSFDSVQYVYNKMGSLAQNSLSDVVSFYSRKQRAGYPEFQNHLKIFHKNSSDLQDYLN 220
            + +L+S+++IG +  EDL   N+LG+G+ R TA+NGRR ST   YL+  + R+N  ++ NA V K+L++ N+ +  GV V+  G+ + V+A ++VI+SAG++N+PQLLMLS IG K HLESKNI C V+LP VGK LQDHL I V I+G      S+ EK      Y YN+ G LAQ+     ++FYSR + A YPEF+ HL  ++KNS+D +++ +
Sbjct:  223 KNLLESYNQIGLEIHEDLQLANLLGAGLSRDTAYNGRRASTATTYLSQIQHRENFKIMKNAFVVKILLDDNS-KVYGVVVKYKGEEIKVYASNEVIISAGSINSPQLLMLSGIGEKNHLESKNIDCKVDLPGVGKNLQDHLTINVPIFGTMPYSQSEIEKLISFPLYSYNRTGLLAQSGFPHTLAFYSRNRNATYPEFEVHLDFWYKNSTDAKNFFS 438          
The following BLAST results are available for this feature:
BLAST of OSCA026109-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|914568265|gb|KOB72263.1|2.647e-7857.14Uncharacterized protein OBRU01_12558 [Operophtera ... [more]
gi|768421339|ref|XP_011551476.1|1.612e-7754.87PREDICTED: glucose dehydrogenase [FAD, quinone]-li... [more]
gi|943971889|ref|XP_014367484.1|3.772e-6449.34PREDICTED: glucose dehydrogenase [FAD, quinone]-li... [more]
gi|930667156|gb|KPJ08244.1|6.181e-6249.55Glucose dehydrogenase [acceptor] [Papilio machaon][more]
gi|930660712|gb|KPJ02687.1|1.803e-6148.46Glucose dehydrogenase [acceptor] [Papilio xuthus][more]
gi|910331533|ref|XP_013169097.1|2.469e-6148.02PREDICTED: glucose dehydrogenase [FAD, quinone]-li... [more]
gi|512887536|ref|XP_004921941.1|2.126e-5846.70PREDICTED: glucose dehydrogenase [FAD, quinone]-li... [more]
gi|930660714|gb|KPJ02689.1|5.152e-5648.57Glucose dehydrogenase [acceptor] [Papilio xuthus][more]
gi|910331562|ref|XP_013169112.1|8.637e-5648.10PREDICTED: glucose dehydrogenase [FAD, quinone]-li... [more]
gi|910331315|ref|XP_013168980.1|2.664e-5546.08PREDICTED: glucose dehydrogenase [FAD, quinone]-li... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0055114 oxidation-reduction process
molecular_function GO:0050660 flavin adenine dinucleotide binding
molecular_function GO:0016491 oxidoreductase activity
molecular_function GO:0016614 oxidoreductase activity, acting on CH-OH group of donors
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000172Glucose-methanol-choline oxidoreductase, N-terminalPFAMPF00732GMC_oxred_Ncoord: 4..144
e-value: 1.0E-34
score: 119.9
NoneNo IPR availableGENE3D3.50.50.60coord: 4..151
e-value: 5.1E-45
score: 152.9
NoneNo IPR availablePANTHERPTHR11552GLUCOSE-METHANOL-CHOLINE (GMC) OXIDOREDUCTASEcoord: 2..205
NoneNo IPR availableSUPERFAMILY51905FAD/NAD(P)-binding domaincoord: 6..183

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_11009contignewscf_11009:5403..6083 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA026109-RAOSCA026109-RAOstrinia scapulalismRNAnewscf_11009 5403..6083 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA026109-PA ID=OSCA026109-PA|Name=OSCA026109-RA|organism=Ostrinia scapulalis|type=polypeptide|length=227bp
SLTQKVLQSWDEIGFKTVEDLNYNNVLGSGIFRVTAFNGRRGSTDHVYLN
PARSRKNLFVITNALVTKVLINSNTLEANGVEVERDGKLMNVFAKSKVIL
SAGTVNTPQLLMLSRIGPKEHLESKNIRCLVNLPAVGKYLQDHLMIPVTI
YGDGDSEPSQAEKSFDSVQYVYNKMGSLAQNSLSDVVSFYSRKQRAGYPE
FQNHLKIFHKNSSDLQDYLNKTVGYKE
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0016491oxidoreductase activity
GO:0016614oxidoreductase activity, acting on CH-OH group of donors
GO:0050660flavin adenine dinucleotide binding
Vocabulary: Biological Process
TermDefinition
GO:0055114oxidation-reduction process
Vocabulary: INTERPRO
TermDefinition
IPR000172GMC_OxRdtase_N