OSCA026109-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA026109-RA
Unique NameOSCA026109-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length227
Homology
BLAST of OSCA026109-RA vs. genbank:protein
Match: gi|943972300|ref|XP_014367656.1| (PREDICTED: glucose dehydrogenase [FAD, quinone]-like [Papilio machaon])

HSP 1 Score: 194.512 bits (493), Expect = 6.203e-55
Identity = 99/212 (46.70%), Postives = 147/212 (69.34%), Query Frame = 0
Query:    2 LTQKVLQSWDEIGFKTVEDLNYNNVLGSGIFRVTAFNGRRGSTDHVYLNPARSRKNLFVITNALVTKVLINSNTLEANGVEVERDGKLMNVFAKSKVILSAGTVNTPQLLMLSRIGPKEHLESKNIRCLVNLPAVGKYLQDHLMIPVTIYGDGDSEPSQAEKSFDSVQYVYNKMGSLAQNSLSDVVSFYSRKQRAGYPEFQNHLKIFHKNSS 213
            L + +L+S+++IG +  EDL+  N+LG+G+ R TA+NG R ST   YL+  + R+N  +I NA V K+L++SN+ +A GV V+  GK + VFA  +VI+SAG++N+PQLLMLS IG K+HLESK+I C V+LP VGK LQDHL I + I+G      ++ E+      Y YN+ G L+Q++   +++FYSR + A YPEF+ H+ ++ KNSS
Sbjct:  219 LVKNLLESYNQIGLQKQEDLHLANLLGAGLSRDTAYNGIRASTATTYLSQIQHRENFKLIKNAFVVKILLDSNS-KAYGVVVKYRGKEIKVFASEEVIISAGSINSPQLLMLSGIGEKKHLESKDIACKVDLPGVGKNLQDHLTINIPIFGTQPDYQNEIEEYLSFALYSYNRTGLLSQSNFPHLIAFYSRNKNAKYPEFEAHVNVWRKNSS 429          
BLAST of OSCA026109-RA vs. genbank:protein
Match: gi|909576064|ref|XP_013143789.1| (PREDICTED: glucose dehydrogenase [FAD, quinone]-like, partial [Papilio polytes])

HSP 1 Score: 194.897 bits (494), Expect = 8.122e-55
Identity = 101/219 (46.12%), Postives = 149/219 (68.04%), Query Frame = 0
Query:    2 LTQKVLQSWDEIGFKTVEDLNYNNVLGSGIFRVTAFNGRRGSTDHVYLNPARSRKNLFVITNALVTKVLINSNTLEANGVEVERDGKLMNVFAKSKVILSAGTVNTPQLLMLSRIGPKEHLESKNIRCLVNLPAVGKYLQDHLMIPVTIYGDGDSEPSQAEKSFDSVQYVYNKMGSLAQNSLSDVVSFYSRKQRAGYPEFQNHLKIFHKNSSDLQDYLN 220
            L +K+L S+++IG +T EDL   N+LGSGI R TA+NGRR ST   YL+  + R+N  ++ NA V +++++S + +  GV V+  GK + VFA ++VI+SAG+VN+PQLLMLS IG K+HLESKNI C V+LP VGK LQDHL I + I+G      S+ ++      Y YN+ G LAQ+     ++FYSR + A  PEF+ HL  ++KNS++ +++ +
Sbjct:  255 LVKKILVSYNQIGLETREDLQLANLLGSGITRDTAYNGRRASTATTYLSQIQHRENFKILKNAFVVQIMLDSQS-KVYGVVVKYKGKEIKVFASNEVIISAGSVNSPQLLMLSGIGEKKHLESKNITCKVDLPGVGKNLQDHLTINLPIFGTLPRSQSRIDEYLKFALYSYNRTGLLAQSGFPHTLAFYSRNKNATNPEFEVHLANWYKNSTEAKNFFS 472          
BLAST of OSCA026109-RA vs. genbank:protein
Match: gi|827537115|ref|XP_012545922.1| (PREDICTED: glucose dehydrogenase [FAD, quinone]-like [Bombyx mori])

HSP 1 Score: 188.734 bits (478), Expect = 5.784e-54
Identity = 96/179 (53.63%), Postives = 127/179 (70.95%), Query Frame = 0
Query:    2 LTQKVLQSWDEIGFKTVEDL-NYNNVLGSGIFRVTAFNGRRGSTDHVYLNPARSRKNLFVITNALVTKVLINSNTLEANGVEVERDGKLMNVFAKSKVILSAGTVNTPQLLMLSRIGPKEHLESKNIRCLVNLPAVGKYLQDHLMIPVTIYGDGDSEPSQAEKSFDSVQYVYNKMGSLA 179
            +  K++++WDEIGFK V D+ N NN+ GSG FR +A +G R ST   YLNP ++RKNLF++ NALVTKVLIN+ T E  GV VE  GK    +A  +VILSAG++NTPQLLMLS +GP+EHL SKNI C VN   VG+ LQDH ++ V ++G    + + AEKSF ++QY+Y + G L 
Sbjct:  185 IADKIIEAWDEIGFKKVLDVSNLNNLRGSGRFRASAASGTRESTAKAYLNPIKNRKNLFIVKNALVTKVLINNKTKEVFGVSVEIHGKKFTFYANKEVILSAGSINTPQLLMLSGVGPREHLISKNIFCKVNSRMVGENLQDHGIVLVPVFGKEPEDQTTAEKSFAAIQYLYYREGYLG 363          
BLAST of OSCA026109-RA vs. genbank:protein
Match: gi|909576062|ref|XP_013143788.1| (PREDICTED: glucose dehydrogenase [FAD, quinone]-like [Papilio polytes])

HSP 1 Score: 189.119 bits (479), Expect = 3.685e-53
Identity = 101/226 (44.69%), Postives = 147/226 (65.04%), Query Frame = 0
Query:    2 LTQKVLQSWDEIGFKTVEDLNYNNVLGSGIFRVTAFNGRRGSTDHVYLNPARSRKNLFVITNALVTKVLINSNTLEANGVEVERDGKLMNVFAKSKVILSAGTVNTPQLLMLSRIGPKEHLESKNIRCLVNLPAVGKYLQDHLMIPVTIYGDGDSEPSQAEKSFDSVQYVYNKMGSLAQNSLSDVVSFYSRKQRAGYPEFQNHLKIFHKNSSDLQDYLNKTVGYKE 227
            L + + +S+ +IG +  EDL+  N+LG G+ R TA+NG+R ST   YL+  + R+N  +I NA V K+L+NS   +  GV V+  GK + VFA ++VI+S G++N+PQLLMLS IG K+HLESKNI C V+LP VGK LQDHL I V I+G      ++     +   Y YN+ G LAQ++   +++FYSR + A +PEF+ HL  +HKNS   +++ +    YKE
Sbjct:  184 LIENLKESYSQIGLERHEDLHLGNLLGVGLSRDTAYNGKRASTATTYLSQIQHRENFKLIKNAFVLKILLNSQ-YKVYGVVVKYKGKEIKVFASNEVIISGGSINSPQLLMLSGIGEKKHLESKNITCKVDLPGVGKNLQDHLTINVPIFGTTSYSQNKINNYLNVALYSYNRTGGLAQSNYPHLLAFYSRNRNATHPEFEVHLDFWHKNSPQAKNFFSM---YKE 405          
BLAST of OSCA026109-RA vs. genbank:protein
Match: gi|389609233|dbj|BAM18228.1| (glucose dehydrogenase [Papilio xuthus])

HSP 1 Score: 149.828 bits (377), Expect = 4.664e-40
Identity = 77/160 (48.12%), Postives = 107/160 (66.88%), Query Frame = 0
Query:   61 ITNALVTKVLINSNTLEANGVEVERDGKLMNVFAKSKVILSAGTVNTPQLLMLSRIGPKEHLESKNIRCLVNLPAVGKYLQDHLMIPVTIYGDGDSEPSQAEKSFDSVQYVYNKMGSLAQNSLSDVVSFYSRKQRAGYPEFQNHLKIFHKNSSDLQDYLN 220
            + NA V K+L++ N+ +  GV V+  G+ + VFA  +VI+SAG++N+PQLLMLS IG K HLESKNI C V+LP VGK LQDHL I V I+G      S+ EK      Y YN+ G LAQ+     ++FYSR + A YPEF+ HL  ++KNS+D +++ +
Sbjct:    1 MKNAFVVKILLDDNS-KVYGVVVKYKGEEIKVFASEEVIISAGSINSPQLLMLSGIGEKNHLESKNIDCKVDLPGVGKNLQDHLTINVPIFGTMPYSQSEIEKLISFPLYSYNRTGLLAQSGFPHTLAFYSRNRNATYPEFEVHLDFWYKNSTDAKNFFS 159          
BLAST of OSCA026109-RA vs. genbank:protein
Match: gi|910328610|ref|XP_013167526.1| (PREDICTED: glucose dehydrogenase [FAD, quinone]-like [Papilio xuthus])

HSP 1 Score: 140.198 bits (352), Expect = 7.997e-35
Identity = 82/214 (38.32%), Postives = 128/214 (59.81%), Query Frame = 0
Query:    2 LTQKVLQSWDEIGFKTVEDLNYNNVLGSGIFRVTAFNGRRGSTDHVYLNPARSRKNLFVITNALVTKVLINSNTLEANGVEVERDGKLMNVFAKSKVILSAGTVNTPQLLMLSRIGPKEHLESKNIRCLVNLPAVGKYLQDHLMIPVTIYGDGDSEPSQ-AEKSFDSV-----QYVYNKMGSLAQNSLSDVVSFY-SRKQRAGYPEFQNHLKIF 208
            + + +L   +EIG   ++D N  N +G+ I   T  +G R ST   +L+  + R+NL V+ +A VTK+L + NT +  GV +++DGK + V AK ++I+SAG++NTPQLLMLS IGP++HLES +I  + +LP VG+ LQDH+  P+       S P+     SFD++      Y++   G LA  + S V++F  +  Q A  PE Q H  ++
Sbjct:  213 IEEMILSGMNEIGVNEIDDSNGANQMGASIAYNTIKDGIRHSTARAFLSVIKDRRNLHVLKDAYVTKILFHPNTNKMKGVLIQKDGKEIQVIAKKELIISAGSINTPQLLMLSGIGPRKHLESLDIEAIADLP-VGENLQDHVFFPIYY-----SSPTNLILTSFDNIGTGFLDYMFTNKGMLADTTPSRVIAFVNASDQDAITPEVQYHFPVY 420          
BLAST of OSCA026109-RA vs. genbank:protein
Match: gi|943948416|ref|XP_014357263.1| (PREDICTED: glucose dehydrogenase [FAD, quinone]-like isoform X2 [Papilio machaon])

HSP 1 Score: 139.813 bits (351), Expect = 9.655e-35
Identity = 83/229 (36.24%), Postives = 135/229 (58.95%), Query Frame = 0
Query:    2 LTQKVLQSWDEIGFKTVEDLNYNNVLGSGIFRVTAFNGRRGSTDHVYLNPARSRKNLFVITNALVTKVLINSNTLEANGVEVERDGKLMNVFAKSKVILSAGTVNTPQLLMLSRIGPKEHLESKNIRCLVNLPAVGKYLQDHLMIPVTIYGDGDSEPSQAEKSFDS--VQYVYNKMGSLAQNSLSDVVSFYSRKQRAGY-PEFQNHLKIFHKNSSDLQDYLNKTVGYKE 227
            + + +L   +EIG   ++D N  N +G+ I   T  +G R ST   +L+  + RKNL V+ +A VTK+L + NT +  GV +++DGK + V AK ++I+SAG++NTPQLL+LS IGP++HLES +I  + +LP VG+ LQDH+  P+ IY   ++E         S  ++Y++   G  +  + S V++F +  + A   PE Q H  ++    S+  D L    G+K+
Sbjct:  189 IEEIILNGMNEIGVNEIDDANGANQMGATISYTTIKDGIRHSTARAFLSVIKDRKNLHVLKDAYVTKILFHPNTNKMKGVLIQKDGKEIQVVAKKELIISAGSINTPQLLLLSGIGPRKHLESLDIEVIADLP-VGENLQDHVFFPI-IYSSPNNESLMTFSKIGSNFLEYMFTNEGQFSDITPSRVIAFLNASEPAAVSPEVQYHFAVYSPQVSNYID-LYDLHGFKD 414          
BLAST of OSCA026109-RA vs. genbank:protein
Match: gi|943948409|ref|XP_014357260.1| (PREDICTED: glucose dehydrogenase [FAD, quinone]-like isoform X1 [Papilio machaon] >gi|943948411|ref|XP_014357261.1| PREDICTED: glucose dehydrogenase [FAD, quinone]-like isoform X1 [Papilio machaon] >gi|943948413|ref|XP_014357262.1| PREDICTED: glucose dehydrogenase [FAD, quinone]-like isoform X1 [Papilio machaon])

HSP 1 Score: 139.428 bits (350), Expect = 1.318e-34
Identity = 80/219 (36.53%), Postives = 130/219 (59.36%), Query Frame = 0
Query:    2 LTQKVLQSWDEIGFKTVEDLNYNNVLGSGIFRVTAFNGRRGSTDHVYLNPARSRKNLFVITNALVTKVLINSNTLEANGVEVERDGKLMNVFAKSKVILSAGTVNTPQLLMLSRIGPKEHLESKNIRCLVNLPAVGKYLQDHLMIPVTIYGDGDSEPSQAEKSFDS--VQYVYNKMGSLAQNSLSDVVSFYSRKQRAGY-PEFQNHLKIFHKNSSDLQD 217
            + + +L   +EIG   ++D N  N +G+ I   T  +G R ST   +L+  + RKNL V+ +A VTK+L + NT +  GV +++DGK + V AK ++I+SAG++NTPQLL+LS IGP++HLES +I  + +LP VG+ LQDH+  P+ IY   ++E         S  ++Y++   G  +  + S V++F +  + A   PE Q H  ++    S+  D
Sbjct:  213 IEEIILNGMNEIGVNEIDDANGANQMGATISYTTIKDGIRHSTARAFLSVIKDRKNLHVLKDAYVTKILFHPNTNKMKGVLIQKDGKEIQVVAKKELIISAGSINTPQLLLLSGIGPRKHLESLDIEVIADLP-VGENLQDHVFFPI-IYSSPNNESLMTFSKIGSNFLEYMFTNEGQFSDITPSRVIAFLNASEPAAVSPEVQYHFAVYSPQVSNYID 429          
BLAST of OSCA026109-RA vs. genbank:protein
Match: gi|930675707|gb|KPJ15963.1| (Glucose dehydrogenase [acceptor] [Papilio machaon])

HSP 1 Score: 139.813 bits (351), Expect = 2.541e-34
Identity = 83/229 (36.24%), Postives = 135/229 (58.95%), Query Frame = 0
Query:    2 LTQKVLQSWDEIGFKTVEDLNYNNVLGSGIFRVTAFNGRRGSTDHVYLNPARSRKNLFVITNALVTKVLINSNTLEANGVEVERDGKLMNVFAKSKVILSAGTVNTPQLLMLSRIGPKEHLESKNIRCLVNLPAVGKYLQDHLMIPVTIYGDGDSEPSQAEKSFDS--VQYVYNKMGSLAQNSLSDVVSFYSRKQRAGY-PEFQNHLKIFHKNSSDLQDYLNKTVGYKE 227
            + + +L   +EIG   ++D N  N +G+ I   T  +G R ST   +L+  + RKNL V+ +A VTK+L + NT +  GV +++DGK + V AK ++I+SAG++NTPQLL+LS IGP++HLES +I  + +LP VG+ LQDH+  P+ IY   ++E         S  ++Y++   G  +  + S V++F +  + A   PE Q H  ++    S+  D L    G+K+
Sbjct:  347 IEEIILNGMNEIGVNEIDDANGANQMGATISYTTIKDGIRHSTARAFLSVIKDRKNLHVLKDAYVTKILFHPNTNKMKGVLIQKDGKEIQVVAKKELIISAGSINTPQLLLLSGIGPRKHLESLDIEVIADLP-VGENLQDHVFFPI-IYSSPNNESLMTFSKIGSNFLEYMFTNEGQFSDITPSRVIAFLNASEPAAVSPEVQYHFAVYSPQVSNYID-LYDLHGFKD 572          

HSP 2 Score: 110.538 bits (275), Expect = 3.300e-24
Identity = 74/223 (33.18%), Postives = 119/223 (53.36%), Query Frame = 0
Query:    6 VLQSWDEIGFKTVEDLNYNNVLGSGIFRVTAFNGRRGSTDHVYLNPARSRKNLFVITNALVTKVLINSNTLEANGVEVERDGKLMNVFAKSKVILSAGTVNTPQLLMLSRIGPKEHLESKNIRCLVNLPAVGKYLQDHLMIPVTIYGDGDSEPSQAE--------KSFDSVQYVYNKMGSLAQNSLSDVVSFY-SRKQRAGYPEFQNHLKIFHKNSSDLQDYL 219
            ++++  E+G K + D+N  + +G      T  +G+R ST   +L+  R R NL V+ N  V+K+L +  + +  G+ ++++ + + V AK +VILSAG++NTP LL+LS IGPKEHL+S NI    +LP VG+ LQDH+  P        S P++ +         +F   +Y+    G  A  +   +++F  S    A  PE Q H  +      DL D L
Sbjct: 1041 IIKAATEVGIKHLNDINGASQMGITRSYSTIKDGKRHSTARAFLSVIRDRPNLHVMKNGFVSKILFHPKSNKVRGILIQKENEEIVVNAKKEVILSAGSINTPHLLLLSGIGPKEHLDSFNIEVKADLP-VGENLQDHVFFPTYF-----STPTEQKLVTLPAITTAFS--EYILTNEGLYADVNPHRIIAFVNSSDPVAISPEVQFHYLVLPPKMDDLIDIL 1255          
BLAST of OSCA026109-RA vs. genbank:protein
Match: gi|685192687|gb|AIO02860.1| (ecdysone oxidase [Bombyx mori])

HSP 1 Score: 137.502 bits (345), Expect = 1.033e-33
Identity = 77/178 (43.26%), Postives = 113/178 (63.48%), Query Frame = 0
Query:    4 QKVLQSWDEIGFKTVEDLNYNNVLGSGIFRVTAFNGRRGSTDHVYLNPARSRKNLFVITNALVTKVLINSNTLEANGVEVERDGKLMNVFAKSKVILSAGTVNTPQLLMLSRIGPKEHLESKNIRCLVNLPAVGKYLQDHLMIPVTIYGD-GDSEPSQAEKSFDSVQYVYNKMGSLAQ 180
            +K LQ+++E+GFKTV D+ Y N +G+G F  T  NG R S+    LN A S  +L ++ +A VTK++I + T  A G+E  +D K    +A  +VILSAGT NTP+LLMLS +GP EHL S  I  + +LP VG  L DH+M+   +  D G     +AE S ++++Y+Y++ G LA+
Sbjct:  209 KKFLQAFEELGFKTVPDMTYPNSIGAGCFSHTIRNGERDSSLRALLNNANS-TSLHILKDAFVTKIIIENGT--AIGIEAVKDDKKFLFYADREVILSAGTFNTPKLLMLSGVGPSEHLRSLGIDVVADLP-VGSNLHDHVMVLAFLVADNGTCVSDEAENSMEAIKYLYDRTGFLAK 382          
The following BLAST results are available for this feature:
BLAST of OSCA026109-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|943972300|ref|XP_014367656.1|6.203e-5546.70PREDICTED: glucose dehydrogenase [FAD, quinone]-li... [more]
gi|909576064|ref|XP_013143789.1|8.122e-5546.12PREDICTED: glucose dehydrogenase [FAD, quinone]-li... [more]
gi|827537115|ref|XP_012545922.1|5.784e-5453.63PREDICTED: glucose dehydrogenase [FAD, quinone]-li... [more]
gi|909576062|ref|XP_013143788.1|3.685e-5344.69PREDICTED: glucose dehydrogenase [FAD, quinone]-li... [more]
gi|389609233|dbj|BAM18228.1|4.664e-4048.13glucose dehydrogenase [Papilio xuthus][more]
gi|910328610|ref|XP_013167526.1|7.997e-3538.32PREDICTED: glucose dehydrogenase [FAD, quinone]-li... [more]
gi|943948416|ref|XP_014357263.1|9.655e-3536.24PREDICTED: glucose dehydrogenase [FAD, quinone]-li... [more]
gi|943948409|ref|XP_014357260.1|1.318e-3436.53PREDICTED: glucose dehydrogenase [FAD, quinone]-li... [more]
gi|930675707|gb|KPJ15963.1|2.541e-3436.24Glucose dehydrogenase [acceptor] [Papilio machaon][more]
gi|685192687|gb|AIO02860.1|1.033e-3343.26ecdysone oxidase [Bombyx mori][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0055114 oxidation-reduction process
molecular_function GO:0050660 flavin adenine dinucleotide binding
molecular_function GO:0016491 oxidoreductase activity
molecular_function GO:0016614 oxidoreductase activity, acting on CH-OH group of donors
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000172Glucose-methanol-choline oxidoreductase, N-terminalPFAMPF00732GMC_oxred_Ncoord: 4..144
e-value: 1.0E-34
score: 119.9
NoneNo IPR availableGENE3D3.50.50.60coord: 4..151
e-value: 5.1E-45
score: 152.9
NoneNo IPR availablePANTHERPTHR11552GLUCOSE-METHANOL-CHOLINE (GMC) OXIDOREDUCTASEcoord: 2..205
NoneNo IPR availableSUPERFAMILY51905FAD/NAD(P)-binding domaincoord: 6..183

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_11009contignewscf_11009:5403..6083 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA026109-RAOSCA026109-RAOstrinia scapulalismRNAnewscf_11009 5403..6083 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA026109-PA ID=OSCA026109-PA|Name=OSCA026109-RA|organism=Ostrinia scapulalis|type=polypeptide|length=227bp
SLTQKVLQSWDEIGFKTVEDLNYNNVLGSGIFRVTAFNGRRGSTDHVYLN
PARSRKNLFVITNALVTKVLINSNTLEANGVEVERDGKLMNVFAKSKVIL
SAGTVNTPQLLMLSRIGPKEHLESKNIRCLVNLPAVGKYLQDHLMIPVTI
YGDGDSEPSQAEKSFDSVQYVYNKMGSLAQNSLSDVVSFYSRKQRAGYPE
FQNHLKIFHKNSSDLQDYLNKTVGYKE
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0016491oxidoreductase activity
GO:0016614oxidoreductase activity, acting on CH-OH group of donors
GO:0050660flavin adenine dinucleotide binding
Vocabulary: Biological Process
TermDefinition
GO:0055114oxidation-reduction process
Vocabulary: INTERPRO
TermDefinition
IPR000172GMC_OxRdtase_N