OSCA026111-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA026111-RA
Unique NameOSCA026111-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length237
Homology
BLAST of OSCA026111-RA vs. genbank:protein
Match: gi|914567251|gb|KOB71578.1| (Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha [Operophtera brumata])

HSP 1 Score: 310.842 bits (795), Expect = 4.073e-100
Identity = 170/222 (76.58%), Postives = 188/222 (84.68%), Query Frame = 0
Query:    1 SYDETDEDCLSPNLDEITNTEVVEDSSVEESTLSEGMPGPAGRLREPPG-PNNAANNAAGYVNLSSIYSIGSNDRWNQNQPAPKNGLPDKKLPEKPVPPEKPVSLMMVNGKMDNRYSGFGNNSFLYSHLL-AGGARAKDPPSYTAATSGALFDK-DKKATSPVKTKSPVTSPVNGVNKISDNYEKAVAERLSPQREVARLNRSSVFSKVNTGVVANKVKKTK 219
            SYDETDEDCLSPN+DEIT+TEV+EDSSVEESTLS+GMP P GRLREP   P   A+   GYVNLSSIYSIGS +R N   P P N L  K+  EKP+PPEKPVSLMMVNGKMDNRY+GFGNNSFLYS LL A GARAKDPPSYTAAT+ ALF+K  +K TSP K KSPVTSPVNG+NKISDNYE+AVAERLSPQREV+RLNRSS+FSKVNTGVV+ KVKK +
Sbjct:  320 SYDETDEDCLSPNMDEITSTEVIEDSSVEESTLSDGMPVP-GRLREPLNNPVRTASGNPGYVNLSSIYSIGS-ERLNHQNP-PNNSLEKKQ--EKPIPPEKPVSLMMVNGKMDNRYAGFGNNSFLYSQLLGASGARAKDPPSYTAATA-ALFEKAAEKNTSPTKPKSPVTSPVNGMNKISDNYERAVAERLSPQREVSRLNRSSLFSKVNTGVVSGKVKKAR 535          
BLAST of OSCA026111-RA vs. genbank:protein
Match: gi|930651156|gb|KPI93500.1| (Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha [Papilio xuthus])

HSP 1 Score: 298.13 bits (762), Expect = 1.247e-93
Identity = 178/257 (69.26%), Postives = 198/257 (77.04%), Query Frame = 0
Query:    1 SYDETDEDCLSPNLDEITNTEVVEDSSVEESTLSEGMPGPAGRLREPPGPN-------NAANNAAGYVNLSSIYSIGSNDRW-NQNQPAPKNGLPDKKLPEKPVPPEKPVSLMMVNGKMDNRYSGFGNNSFLYSHLL-AGGARAKDPPSYTAATSGALFDK----DKKATSPVKT---KSPVTSPVNGVNKISDNYEKAVAERLSPQREVARLNRSSVFSKVNTGVVANKVKKTKPR----DDEYDDYARDSDECSI 237
            SYDETDEDCLSPN+DEITNTEV E+SSVEESTLS+       R +EP             A   AG+VNLSSIYSIG  +RW NQ     KNGLPD+K  EKP+PPEKPVSL+M+NGK+DNRYSGF NNSFLYS LL   GARAKDPPSYTAAT GA FDK     K ATSP+KT   KSPVTSPVNGVNKISDNYE+A+AERLSPQR+++RLNRSS+FSKVNTGVV+ KVKK  PR    DDE +DYARDSDECSI
Sbjct:  445 SYDETDEDCLSPNIDEITNTEVAEESSVEESTLSDSASSVLSRGKEPASARLQPAPAATTAPPTAGFVNLSSIYSIGGANRWPNQPDNVSKNGLPDRK-TEKPIPPEKPVSLLMMNGKVDNRYSGFSNNSFLYSQLLNPTGARAKDPPSYTAATGGA-FDKAAEIKKTATSPIKTPVNKSPVTSPVNGVNKISDNYERAIAERLSPQRDISRLNRSSLFSKVNTGVVSGKVKKNSPRRSGNDDEDEDYARDSDECSI 699          
BLAST of OSCA026111-RA vs. genbank:protein
Match: gi|913323747|ref|XP_013193153.1| (PREDICTED: serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta-like [Amyelois transitella])

HSP 1 Score: 298.901 bits (764), Expect = 8.130e-92
Identity = 176/237 (74.26%), Postives = 195/237 (82.28%), Query Frame = 0
Query:    1 SYDETDEDCLSPNLDEITNTEVVEDSSVEESTLSEGMPGPAGRLREPPGPNNAANNAAGYVNLSSIYSIGSNDRWNQNQPAPKNGLPDKKLPEKPVPPEKPVSLMMVNGKMDNRYSGFGNNSFLYSHLLAGGARAKDPPSYTAATSGALFDKDKKATSPVKTKSPVTSPVNGVNKISDNYEKAVAERLSPQREVARLNRSSVFSKVNTGVVANKVKKTKPRDDEYDDYARDSDECSI 237
            SYDETDE  LSPN+D+ TNTEVVEDSSVEESTLSEG P      REP         +AG+VNLSSIYSIG ND+W  NQP  KNG PDKK  +    PEKPVSLMMVNGKMDNRY+GFGNNSFLYSHLL GGARAKDPPSYTAATSGALF+K+ +ATSP K KSPVTSPVNGVNKISDNYE+AVAERLSPQRE AR NRSS+FSKVNTG+V++K+KK    D++ +DYARDSDECSI
Sbjct:  736 SYDETDEG-LSPNMDDYTNTEVVEDSSVEESTLSEGGP----LWREP--------TSAGFVNLSSIYSIGGNDKW-ANQPN-KNGFPDKKPEKPVP-PEKPVSLMMVNGKMDNRYAGFGNNSFLYSHLLTGGARAKDPPSYTAATSGALFEKE-RATSP-KPKSPVTSPVNGVNKISDNYERAVAERLSPQRETAR-NRSSLFSKVNTGIVSSKIKKNIRNDEDDEDYARDSDECSI 953          
BLAST of OSCA026111-RA vs. genbank:protein
Match: gi|943955068|ref|XP_014360496.1| (PREDICTED: serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta-like [Papilio machaon] >gi|930673204|gb|KPJ13752.1| Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha [Papilio machaon])

HSP 1 Score: 290.041 bits (741), Expect = 1.634e-91
Identity = 180/261 (68.97%), Postives = 202/261 (77.39%), Query Frame = 0
Query:    1 SYDETDEDCLSPNLDEITNTEVVEDSSVEESTLSEGMPGPAGRLREPPGPNNAANNAA-----------GYVNLSSIYSIGSNDRW-NQNQPAPKNGLPDKKLPEKPVPPEKPVSLMMVNGKMDNRYSGFGNNSFLYSHLLA-GGARAKDPPSYTAATSGALFDK----DKKATSPVKT---KSPVTSPVNGVNKISDNYEKAVAERLSPQREVARLNRSSVFSKVNTGVVANKVKKTKPR----DDEYDDYARDSDECSI 237
            SYDETDEDCLSPN+DEITNTEV E+SSVEESTLSE       R +EP    +AA +AA           G+VNLSSIYSIG  +RW NQ   A KNGLPD+K  EKP+PPEKPVSL+M+NGK+DNRY+GF NNSFLYS LL   GARAKDPPSYTAAT GA FDK     K ATS +KT   KSPVTSPVNGVNKISDNYE+A+AERLSPQR+++RLNRSS+FSKVNTGVV+ KVKK  PR    DDE +DYARDSDECSI
Sbjct:  349 SYDETDEDCLSPNVDEITNTEVAEESSVEESTLSESASSVVSRGKEPSAAPSAAPSAAPSAAPSAAPSAGFVNLSSIYSIGGANRWPNQTDNASKNGLPDRK-TEKPIPPEKPVSLLMMNGKVDNRYTGFSNNSFLYSQLLNPTGARAKDPPSYTAATGGA-FDKTAEIKKTATSHIKTPVNKSPVTSPVNGVNKISDNYERAIAERLSPQRDISRLNRSSLFSKVNTGVVSGKVKKNSPRRSGNDDEDEDYARDSDECSI 607          
BLAST of OSCA026111-RA vs. genbank:protein
Match: gi|909554461|ref|XP_013148701.1| (PREDICTED: serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta-like [Papilio polytes])

HSP 1 Score: 290.041 bits (741), Expect = 1.893e-91
Identity = 179/261 (68.58%), Postives = 199/261 (76.25%), Query Frame = 0
Query:    1 SYDETDEDCLSPNLDEITNTEVVEDSSVEESTLSEGMPGPAGRLREPPGPNNAANNAA-----------GYVNLSSIYSIGSNDRWNQNQPA-PKNGLPDKKLPEKPVPPEKPVSLMMVNGKMDNRYSGFGNNSFLYSHLLA-GGARAKDPPSYTAATSGALFDK----DKKATSPVKT---KSPVTSPVNGVNKISDNYEKAVAERLSPQREVARLNRSSVFSKVNTGVVANKVKKTKPR----DDEYDDYARDSDECSI 237
            SYDETDEDCLSPN+DEITNTEV E+SSVEESTLSE       R +E   P      A            G+VNLSSIYSIG  +RW  NQP   KNGLPD+K  EKP+PPEKPVSL+M+NGK+DNRYSGF NNSFLYS LL   GARAKDPPSYTAATSGA FDK     K ATSP+KT   KSPVTSPVNGVNKISDNYE+A+AERLSPQR+++RLNRSS+FSKVNTGVV+ KVKK  PR    D+E +DYARDSDECSI
Sbjct:  349 SYDETDEDCLSPNIDEITNTEVAEESSVEESTLSESAASVVSRGKEQSAPRPQPAAAPAANTAPAAPAAGFVNLSSIYSIGGANRW-PNQPDNAKNGLPDRK-TEKPIPPEKPVSLLMMNGKVDNRYSGFSNNSFLYSQLLNPTGARAKDPPSYTAATSGA-FDKTGEIKKAATSPIKTPINKSPVTSPVNGVNKISDNYERAIAERLSPQRDISRLNRSSLFSKVNTGVVSGKVKKNSPRRSGNDEEDEDYARDSDECSI 606          
BLAST of OSCA026111-RA vs. genbank:protein
Match: gi|910327613|ref|XP_013166992.1| (PREDICTED: uncharacterized protein LOC106117298 [Papilio xuthus])

HSP 1 Score: 298.13 bits (762), Expect = 2.288e-91
Identity = 178/257 (69.26%), Postives = 198/257 (77.04%), Query Frame = 0
Query:    1 SYDETDEDCLSPNLDEITNTEVVEDSSVEESTLSEGMPGPAGRLREPPGPN-------NAANNAAGYVNLSSIYSIGSNDRW-NQNQPAPKNGLPDKKLPEKPVPPEKPVSLMMVNGKMDNRYSGFGNNSFLYSHLL-AGGARAKDPPSYTAATSGALFDK----DKKATSPVKT---KSPVTSPVNGVNKISDNYEKAVAERLSPQREVARLNRSSVFSKVNTGVVANKVKKTKPR----DDEYDDYARDSDECSI 237
            SYDETDEDCLSPN+DEITNTEV E+SSVEESTLS+       R +EP             A   AG+VNLSSIYSIG  +RW NQ     KNGLPD+K  EKP+PPEKPVSL+M+NGK+DNRYSGF NNSFLYS LL   GARAKDPPSYTAAT GA FDK     K ATSP+KT   KSPVTSPVNGVNKISDNYE+A+AERLSPQR+++RLNRSS+FSKVNTGVV+ KVKK  PR    DDE +DYARDSDECSI
Sbjct:  730 SYDETDEDCLSPNIDEITNTEVAEESSVEESTLSDSASSVLSRGKEPASARLQPAPAATTAPPTAGFVNLSSIYSIGGANRWPNQPDNVSKNGLPDRKT-EKPIPPEKPVSLLMMNGKVDNRYSGFSNNSFLYSQLLNPTGARAKDPPSYTAATGGA-FDKAAEIKKTATSPIKTPVNKSPVTSPVNGVNKISDNYERAIAERLSPQRDISRLNRSSLFSKVNTGVVSGKVKKNSPRRSGNDDEDEDYARDSDECSI 984          
BLAST of OSCA026111-RA vs. genbank:protein
Match: gi|357617009|gb|EHJ70530.1| (hypothetical protein KGM_09283 [Danaus plexippus])

HSP 1 Score: 291.582 bits (745), Expect = 4.963e-91
Identity = 165/239 (69.04%), Postives = 192/239 (80.33%), Query Frame = 0
Query:    1 SYDETDEDCLSPNLDEITNTEVVEDSSVEESTLSEGMPGPAGRLREPPGPNNAANNAAGYVNLSSIYSIGSNDRWNQNQPAPKNGLPDKKLPEKPVPPEKPVSLMMVNGKMDNRYSGFGNNSFLYSHLL-AGGARAKDPPSYTAATSGALFDK-DKKATSPVKTKSPVTSPVNGVNKISDNYEKAVAERLSPQREVARLNRSSVFSKVNTGVVANKVKKTKPRDDEYDDYARDSDECSI 237
            SYDETD+DCLSPN+D++TNTEV+EDSSVEESTLSEG+ G +  L    GP N    A G+VNLSSIYSIG N++WN+N       LPD+K  +KP+PPEKPVSLMM+N KMD    G GNNSFLYS LL AGGARAKDPPSY AAT G L DK D    +P   KSP +SPVNGV+KISDNYE+AVAERLSPQREVARLNRSSVFSKVNTGVV++KVKKT+ ++D+ +DYAR+SDECSI
Sbjct:  486 SYDETDDDCLSPNVDDVTNTEVIEDSSVEESTLSEGLSGRSPAL----GPVNR-TPAGGFVNLSSIYSIG-NEKWNKN-------LPDRK--DKPIPPEKPVSLMMMNNKMDR--CGLGNNSFLYSQLLNAGGARAKDPPSYMAATGGHLADKSDDAKKTPKTVKSP-SSPVNGVSKISDNYERAVAERLSPQREVARLNRSSVFSKVNTGVVSSKVKKTRNQEDD-EDYARESDECSI 705          
BLAST of OSCA026111-RA vs. genbank:protein
Match: gi|1073533271|gb|JAT83747.1| (hypothetical protein g.10848, partial [Pectinophora gossypiella])

HSP 1 Score: 273.478 bits (698), Expect = 1.559e-90
Identity = 146/182 (80.22%), Postives = 160/182 (87.91%), Query Frame = 0
Query:   66 IYSIGSNDRW-NQNQP-APKNGLPDKKLPEKPVPPEKPVSLMMVNGKMDNRYSGFG-NNSFLYSHLLA---GGARAKDPPSYTAATSGALFDK--DKKATSPVK-TKSPVTSPVNGVNKISDNYEKAVAERLSPQREVARLNRSSVFSKVNTGVVANKVKKT-KPRDDEYDDYARDSDECSI 237
            IYSIGS DRW NQ+QP A KNG P+KKL EKPVPPEKPVSLMMVNGKMDNRY+GFG NNSFLYSHLL    GG RAKDPPSYTAATSGALFDK  +KK TSP K TKSPVTSPVNGVNKISDNYE+AVAERLSPQRE++R+NRSS+FSKVNTGVV++KVK + +  DDE +DYARDSDECSI
Sbjct:    1 IYSIGSGDRWANQHQPTAAKNGFPEKKLSEKPVPPEKPVSLMMVNGKMDNRYAGFGGNNSFLYSHLLGTNPGGTRAKDPPSYTAATSGALFDKNGEKKVTSPNKITKSPVTSPVNGVNKISDNYERAVAERLSPQREISRVNRSSLFSKVNTGVVSSKVKASARSHDDEDEDYARDSDECSI 182          
BLAST of OSCA026111-RA vs. genbank:protein
Match: gi|827539378|ref|XP_012552853.1| (PREDICTED: serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit delta-like isoform X2 [Bombyx mori])

HSP 1 Score: 283.493 bits (724), Expect = 4.506e-87
Identity = 165/239 (69.04%), Postives = 186/239 (77.82%), Query Frame = 0
Query:    1 SYDETDEDCLSPNLDEITNTEVVEDSSVEESTLSEGMPGPAGRLREPPGPNNAANNAAGYVNLSSIYSIGSNDRWNQNQPAPKNGLPDKKLPEKPVPPEKPVSLMMVNGKMDNRYSGFGNNSFLYSHLL-AGGARAKDPPSYTAATSGALFDKDKKATSPVKTKSPVTSPVNGVNKISDNYEKAVAERLSPQREVARLNRSSVFSKVNTGVVANKVKKTKPRDDEYD-DYARDSDECSI 237
            SYDETDEDCLSPN+D+ITNTEVVEDSSVEESTLSEG  GP                A GYVNLS+IYS+G+ +RW Q      NGL +K+LPEKPVPPEKPVSLMMVNGKMDNRYSGF NNSFLYS LL + G R +DPPSY+ AT G   D  K A SPV  +SP TSPVNG+NKISDNYE+A+AERLSPQR+++R+NRS +FSKVNTG+VAN VKK  PR DE D DYARDSDECSI
Sbjct:  592 SYDETDEDCLSPNMDDITNTEVVEDSSVEESTLSEG--GPL---------------APGYVNLSTIYSLGT-ERWKQQNATLNNGLAEKRLPEKPVPPEKPVSLMMVNGKMDNRYSGFSNNSFLYSQLLGSSGVRTRDPPSYSVATGGLDVDT-KNAVSPV--RSPATSPVNGINKISDNYERAIAERLSPQRDISRVNRSGLFSKVNTGIVANNVKKNSPRRDEEDGDYARDSDECSI 809          
BLAST of OSCA026111-RA vs. genbank:protein
Match: gi|827539376|ref|XP_012552852.1| (PREDICTED: serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit delta-like isoform X1 [Bombyx mori])

HSP 1 Score: 283.493 bits (724), Expect = 5.163e-87
Identity = 165/239 (69.04%), Postives = 186/239 (77.82%), Query Frame = 0
Query:    1 SYDETDEDCLSPNLDEITNTEVVEDSSVEESTLSEGMPGPAGRLREPPGPNNAANNAAGYVNLSSIYSIGSNDRWNQNQPAPKNGLPDKKLPEKPVPPEKPVSLMMVNGKMDNRYSGFGNNSFLYSHLL-AGGARAKDPPSYTAATSGALFDKDKKATSPVKTKSPVTSPVNGVNKISDNYEKAVAERLSPQREVARLNRSSVFSKVNTGVVANKVKKTKPRDDEYD-DYARDSDECSI 237
            SYDETDEDCLSPN+D+ITNTEVVEDSSVEESTLSEG  GP                A GYVNLS+IYS+G+ +RW Q      NGL +K+LPEKPVPPEKPVSLMMVNGKMDNRYSGF NNSFLYS LL + G R +DPPSY+ AT G   D  K A SPV  +SP TSPVNG+NKISDNYE+A+AERLSPQR+++R+NRS +FSKVNTG+VAN VKK  PR DE D DYARDSDECSI
Sbjct:  600 SYDETDEDCLSPNMDDITNTEVVEDSSVEESTLSEG--GPL---------------APGYVNLSTIYSLGT-ERWKQQNATLNNGLAEKRLPEKPVPPEKPVSLMMVNGKMDNRYSGFSNNSFLYSQLLGSSGVRTRDPPSYSVATGGLDVDT-KNAVSPV--RSPATSPVNGINKISDNYERAIAERLSPQRDISRVNRSGLFSKVNTGIVANNVKKNSPRRDEEDGDYARDSDECSI 817          
The following BLAST results are available for this feature:
BLAST of OSCA026111-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 11
Match NameE-valueIdentityDescription
gi|914567251|gb|KOB71578.1|4.073e-10076.58Serine/threonine-protein phosphatase 2A regulatory... [more]
gi|930651156|gb|KPI93500.1|1.247e-9369.26Serine/threonine-protein phosphatase 2A regulatory... [more]
gi|913323747|ref|XP_013193153.1|8.130e-9274.26PREDICTED: serine/threonine-protein phosphatase 2A... [more]
gi|943955068|ref|XP_014360496.1|1.634e-9168.97PREDICTED: serine/threonine-protein phosphatase 2A... [more]
gi|909554461|ref|XP_013148701.1|1.893e-9168.58PREDICTED: serine/threonine-protein phosphatase 2A... [more]
gi|910327613|ref|XP_013166992.1|2.288e-9169.26PREDICTED: uncharacterized protein LOC106117298 [P... [more]
gi|357617009|gb|EHJ70530.1|4.963e-9169.04hypothetical protein KGM_09283 [Danaus plexippus][more]
gi|1073533271|gb|JAT83747.1|1.559e-9080.22hypothetical protein g.10848, partial [Pectinophor... [more]
gi|827539378|ref|XP_012552853.1|4.506e-8769.04PREDICTED: serine/threonine-protein phosphatase 2A... [more]
gi|827539376|ref|XP_012552852.1|5.163e-8769.04PREDICTED: serine/threonine-protein phosphatase 2A... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005509 calcium ion binding
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_35774contignewscf_35774:511..1221 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA026111-RAOSCA026111-RAOstrinia scapulalismRNAnewscf_35774 511..1221 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA026111-PA ID=OSCA026111-PA|Name=OSCA026111-RA|organism=Ostrinia scapulalis|type=polypeptide|length=237bp
SYDETDEDCLSPNLDEITNTEVVEDSSVEESTLSEGMPGPAGRLREPPGP
NNAANNAAGYVNLSSIYSIGSNDRWNQNQPAPKNGLPDKKLPEKPVPPEK
PVSLMMVNGKMDNRYSGFGNNSFLYSHLLAGGARAKDPPSYTAATSGALF
DKDKKATSPVKTKSPVTSPVNGVNKISDNYEKAVAERLSPQREVARLNRS
SVFSKVNTGVVANKVKKTKPRDDEYDDYARDSDECSI
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0005509calcium ion binding