OSCA026112-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA026112-RA
Unique NameOSCA026112-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length62
Homology
BLAST of OSCA026112-RA vs. genbank:protein
Match: gi|913307643|ref|XP_013184317.1| (PREDICTED: programmed cell death protein 4 [Amyelois transitella])

HSP 1 Score: 99.7525 bits (247), Expect = 3.130e-23
Identity = 51/64 (79.69%), Postives = 52/64 (81.25%), Query Frame = 0
Query:    1 FERLLDKLPDLVLDTPDAAVLLSNFIARCVADDCLPPRFVQSLAAAELNTHAR----RVATLFS 60
            FERLLDKLPDLVLDTPDA VLLSNFIARCVADDCLPPRFVQ  A AELN HA+    R  TL S
Sbjct:  213 FERLLDKLPDLVLDTPDACVLLSNFIARCVADDCLPPRFVQVQAQAELNPHAKQAIHRAETLLS 276          
BLAST of OSCA026112-RA vs. genbank:protein
Match: gi|930672568|gb|KPJ13149.1| (Programmed cell death protein 4, partial [Papilio machaon])

HSP 1 Score: 97.0561 bits (240), Expect = 3.973e-23
Identity = 48/64 (75.00%), Postives = 53/64 (82.81%), Query Frame = 0
Query:    1 FERLLDKLPDLVLDTPDAAVLLSNFIARCVADDCLPPRFVQSLAAAELNTHAR----RVATLFS 60
            FERL++KLPDLVLDTPDAAVLLSNFIARCVADDCLPPRFV + +  ELN+HAR    R  TL S
Sbjct:   75 FERLMEKLPDLVLDTPDAAVLLSNFIARCVADDCLPPRFVHTPSHKELNSHARQAIQRAETLLS 138          
BLAST of OSCA026112-RA vs. genbank:protein
Match: gi|943956357|ref|XP_014361046.1| (PREDICTED: programmed cell death protein 4 [Papilio machaon])

HSP 1 Score: 96.6709 bits (239), Expect = 1.213e-22
Identity = 48/64 (75.00%), Postives = 53/64 (82.81%), Query Frame = 0
Query:    1 FERLLDKLPDLVLDTPDAAVLLSNFIARCVADDCLPPRFVQSLAAAELNTHAR----RVATLFS 60
            FERL++KLPDLVLDTPDAAVLLSNFIARCVADDCLPPRFV + +  ELN+HAR    R  TL S
Sbjct:  160 FERLMEKLPDLVLDTPDAAVLLSNFIARCVADDCLPPRFVHTPSHKELNSHARQAIQRAETLLS 223          
BLAST of OSCA026112-RA vs. genbank:protein
Match: gi|930663090|gb|KPJ04696.1| (Programmed cell death protein 4 [Papilio xuthus])

HSP 1 Score: 98.2117 bits (243), Expect = 1.292e-22
Identity = 48/64 (75.00%), Postives = 53/64 (82.81%), Query Frame = 0
Query:    1 FERLLDKLPDLVLDTPDAAVLLSNFIARCVADDCLPPRFVQSLAAAELNTHAR----RVATLFS 60
            FERL++KLPDLVLDTPDAAVLLSNFIARCVADDCLPPRFV + +  ELN+HAR    R  TL S
Sbjct:  275 FERLMEKLPDLVLDTPDAAVLLSNFIARCVADDCLPPRFVHTPSHKELNSHARQAIQRAETLLS 338          
BLAST of OSCA026112-RA vs. genbank:protein
Match: gi|910341532|ref|XP_013174480.1| (PREDICTED: programmed cell death protein 4 [Papilio xuthus])

HSP 1 Score: 97.8265 bits (242), Expect = 1.560e-22
Identity = 48/64 (75.00%), Postives = 53/64 (82.81%), Query Frame = 0
Query:    1 FERLLDKLPDLVLDTPDAAVLLSNFIARCVADDCLPPRFVQSLAAAELNTHAR----RVATLFS 60
            FERL++KLPDLVLDTPDAAVLLSNFIARCVADDCLPPRFV + +  ELN+HAR    R  TL S
Sbjct:  213 FERLMEKLPDLVLDTPDAAVLLSNFIARCVADDCLPPRFVHTPSHKELNSHARQAIQRAETLLS 276          
BLAST of OSCA026112-RA vs. genbank:protein
Match: gi|357619349|gb|EHJ71961.1| (hypothetical protein KGM_01193 [Danaus plexippus])

HSP 1 Score: 95.9005 bits (237), Expect = 5.557e-22
Identity = 47/64 (73.44%), Postives = 53/64 (82.81%), Query Frame = 0
Query:    1 FERLLDKLPDLVLDTPDAAVLLSNFIARCVADDCLPPRFVQSLAAAELNTHAR----RVATLFS 60
            FERLL+KLPDLVLDTP+AAVL+SNFIARCVADDCLPP+FVQS   A+LN+ AR    R  TL S
Sbjct:  212 FERLLEKLPDLVLDTPEAAVLMSNFIARCVADDCLPPKFVQSKTGADLNSSARQAINRAETLLS 275          
BLAST of OSCA026112-RA vs. genbank:protein
Match: gi|357628006|gb|EHJ77489.1| (programmed cell death 4a [Danaus plexippus])

HSP 1 Score: 94.3597 bits (233), Expect = 1.328e-21
Identity = 47/64 (73.44%), Postives = 53/64 (82.81%), Query Frame = 0
Query:    1 FERLLDKLPDLVLDTPDAAVLLSNFIARCVADDCLPPRFVQSLAAAELNTHAR----RVATLFS 60
            FERLL+KLPDLVLDTP+AAVL+SNFIARCVADDCLPP+FVQS   A+LN+ AR    R  TL S
Sbjct:  134 FERLLEKLPDLVLDTPEAAVLMSNFIARCVADDCLPPKFVQSKTGADLNSSARQAINRAETLLS 197          
BLAST of OSCA026112-RA vs. genbank:protein
Match: gi|509180167|gb|JAA88204.1| (programmed cell death [Pararge aegeria])

HSP 1 Score: 95.1301 bits (235), Expect = 1.382e-21
Identity = 50/66 (75.76%), Postives = 53/66 (80.30%), Query Frame = 0
Query:    1 FERLLDKLPDLVLDTPDAAVLLSNFIARCVADDCLPPRFVQSLA--AAELNTHAR----RVATLFS 60
            F RLLDKLPDLVLDTPDAAVLLSNFIARCVADDCLPP+FVQ+    + ELNTHAR    R  TL S
Sbjct:  214 FGRLLDKLPDLVLDTPDAAVLLSNFIARCVADDCLPPKFVQTQMDRSQELNTHARQAIHRAETLLS 279          
BLAST of OSCA026112-RA vs. genbank:protein
Match: gi|1073529353|gb|JAT81788.1| (hypothetical protein g.12229 [Pectinophora gossypiella])

HSP 1 Score: 88.5817 bits (218), Expect = 3.392e-19
Identity = 45/64 (70.31%), Postives = 50/64 (78.12%), Query Frame = 0
Query:    1 FERLLDKLPDLVLDTPDAAVLLSNFIARCVADDCLPPRFVQSLAAAELNTHAR----RVATLFS 60
            FERLL +LPDL+LDTPDA +LLSNFIARCVADDCLPPRFVQ+ A  ELN  A+    R  TL S
Sbjct:  213 FERLLARLPDLILDTPDAPILLSNFIARCVADDCLPPRFVQTQAKLELNPPAKQAIHRAETLLS 276          
BLAST of OSCA026112-RA vs. genbank:protein
Match: gi|512901559|ref|XP_004925164.1| (PREDICTED: programmed cell death protein 4-like [Bombyx mori])

HSP 1 Score: 84.7297 bits (208), Expect = 1.661e-18
Identity = 39/41 (95.12%), Postives = 41/41 (100.00%), Query Frame = 0
Query:    1 FERLLDKLPDLVLDTPDAAVLLSNFIARCVADDCLPPRFVQ 41
            FERLL+KLPDLVLDTPDAA+LLSNFIARCVADDCLPPRFVQ
Sbjct:  210 FERLLEKLPDLVLDTPDAALLLSNFIARCVADDCLPPRFVQ 250          
The following BLAST results are available for this feature:
BLAST of OSCA026112-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|913307643|ref|XP_013184317.1|3.130e-2379.69PREDICTED: programmed cell death protein 4 [Amyelo... [more]
gi|930672568|gb|KPJ13149.1|3.973e-2375.00Programmed cell death protein 4, partial [Papilio ... [more]
gi|943956357|ref|XP_014361046.1|1.213e-2275.00PREDICTED: programmed cell death protein 4 [Papili... [more]
gi|930663090|gb|KPJ04696.1|1.292e-2275.00Programmed cell death protein 4 [Papilio xuthus][more]
gi|910341532|ref|XP_013174480.1|1.560e-2275.00PREDICTED: programmed cell death protein 4 [Papili... [more]
gi|357619349|gb|EHJ71961.1|5.557e-2273.44hypothetical protein KGM_01193 [Danaus plexippus][more]
gi|357628006|gb|EHJ77489.1|1.328e-2173.44programmed cell death 4a [Danaus plexippus][more]
gi|509180167|gb|JAA88204.1|1.382e-2175.76programmed cell death [Pararge aegeria][more]
gi|1073529353|gb|JAT81788.1|3.392e-1970.31hypothetical protein g.12229 [Pectinophora gossypi... [more]
gi|512901559|ref|XP_004925164.1|1.661e-1895.12PREDICTED: programmed cell death protein 4-like [B... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005488 binding
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003891Initiation factor eIF-4 gamma, MA3PFAMPF02847MA3coord: 1..36
e-value: 6.7E-7
score: 28.8
IPR003891Initiation factor eIF-4 gamma, MA3PROSITEPS51366MIcoord: 1..45
score: 11.133
IPR016021MIF4-like, type 1/2/3GENE3D1.25.40.180coord: 1..52
e-value: 6.4E-14
score: 51.2
NoneNo IPR availablePANTHERPTHR12626PROGRAMMED CELL DEATH 4coord: 1..57
NoneNo IPR availablePANTHERPTHR12626:SF0MA3 DOMAIN-CONTAINING PROTEINcoord: 1..57
IPR016024Armadillo-type foldSUPERFAMILY48371ARM repeatcoord: 1..46

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_27717contignewscf_27717:49..237 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA026112-RAOSCA026112-RAOstrinia scapulalismRNAnewscf_27717 49..237 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA026112-PA ID=OSCA026112-PA|Name=OSCA026112-RA|organism=Ostrinia scapulalis|type=polypeptide|length=62bp
FERLLDKLPDLVLDTPDAAVLLSNFIARCVADDCLPPRFVQSLAAAELNT
HARRVATLFSSV
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0005488binding
Vocabulary: INTERPRO
TermDefinition
IPR016024ARM-type_fold
IPR016021MIF4-like_typ_1/2/3
IPR003891Initiation_fac_eIF4g_MI