OSCA026113-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA026113-RA
Unique NameOSCA026113-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length63
Homology
BLAST of OSCA026113-RA vs. genbank:protein
Match: gi|357626536|gb|EHJ76592.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 61.6178 bits (148), Expect = 1.424e-9
Identity = 34/52 (65.38%), Postives = 42/52 (80.77%), Query Frame = 0
Query:   13 QAWK-TTKVKQKITSYQRGMERSKLK-KKLDKIRHIKMREITKATNALNYSR 62
            Q WK TTKVK+KI + QRG+ERS LK K++ KIRH K+R IT AT+ALNYS+
Sbjct:  237 QTWKHTTKVKKKIVACQRGLERSMLKIKRIQKIRHTKIRSITNATDALNYSQ 288          
The following BLAST results are available for this feature:
BLAST of OSCA026113-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 1
Match NameE-valueIdentityDescription
gi|357626536|gb|EHJ76592.1|1.424e-965.38endonuclease-reverse transcriptase [Danaus plexipp... [more]
back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0090305 nucleic acid phosphodiester bond hydrolysis
biological_process GO:0006278 RNA-dependent DNA biosynthetic process
molecular_function GO:0004519 endonuclease activity
molecular_function GO:0003964 RNA-directed DNA polymerase activity
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_11820contignewscf_11820:3834..4022 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA026113-RAOSCA026113-RAOstrinia scapulalismRNAnewscf_11820 3834..4022 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA026113-PA ID=OSCA026113-PA|Name=OSCA026113-RA|organism=Ostrinia scapulalis|type=polypeptide|length=63bp
MPLALAMLDIWNQAWKTTKVKQKITSYQRGMERSKLKKKLDKIRHIKMRE
ITKATNALNYSRH
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006278RNA-dependent DNA biosynthetic process
GO:0090305nucleic acid phosphodiester bond hydrolysis
Vocabulary: Molecular Function
TermDefinition
GO:0003964RNA-directed DNA polymerase activity
GO:0004519endonuclease activity