OSCA026114-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA026114-RA
Unique NameOSCA026114-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length87
Homology
BLAST of OSCA026114-RA vs. genbank:protein
Match: gi|357617567|gb|EHJ70865.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 80.4925 bits (197), Expect = 7.586e-16
Identity = 40/57 (70.18%), Postives = 41/57 (71.93%), Query Frame = 0
Query:    4 SHQLQVFVNRCLRRILGIYWPEKISNVELLERCHEIPIDQQITRSSAK---HKTERD 57
            SH+LQVFVN CLRRILGIYWPEKISNV L ERC E PID QI R   K   H   RD
Sbjct:  451 SHRLQVFVNWCLRRILGIYWPEKISNVNLWERCGETPIDLQIKRRKWKWIGHALRRD 507          
BLAST of OSCA026114-RA vs. genbank:protein
Match: gi|357630243|gb|EHJ78503.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 80.4925 bits (197), Expect = 8.064e-16
Identity = 40/57 (70.18%), Postives = 41/57 (71.93%), Query Frame = 0
Query:    4 SHQLQVFVNRCLRRILGIYWPEKISNVELLERCHEIPIDQQITRSSAK---HKTERD 57
            SH+LQVFVN CLRRILGIYWPEKISNV L ERC E PID QI R   K   H   RD
Sbjct:  710 SHRLQVFVNWCLRRILGIYWPEKISNVNLWERCGETPIDLQIKRRKWKWIGHALRRD 766          
BLAST of OSCA026114-RA vs. genbank:protein
Match: gi|357624901|gb|EHJ75502.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 79.337 bits (194), Expect = 2.249e-15
Identity = 40/57 (70.18%), Postives = 41/57 (71.93%), Query Frame = 0
Query:    4 SHQLQVFVNRCLRRILGIYWPEKISNVELLERCHEIPIDQQITRSSAK---HKTERD 57
            SH+LQVFVN CLRRILGIYWPEKISNV L ERC E PID QI R   K   H   RD
Sbjct:  627 SHRLQVFVNWCLRRILGIYWPEKISNVNLWERCGETPIDLQIKRRKWKWIGHALRRD 683          
BLAST of OSCA026114-RA vs. genbank:protein
Match: gi|357611138|gb|EHJ67327.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 73.9442 bits (180), Expect = 4.244e-15
Identity = 35/48 (72.92%), Postives = 38/48 (79.17%), Query Frame = 0
Query:    4 SHQLQVFVNRCLRRILGIYWPEKISNVELLERCHEIPIDQQITRSSAK 51
            SH+LQVFVN CLRRILGIYWPEKISN+ L ER  +IPID QI R   K
Sbjct:    9 SHRLQVFVNWCLRRILGIYWPEKISNMNLWERRGQIPIDLQIKRRKWK 56          
BLAST of OSCA026114-RA vs. genbank:protein
Match: gi|357607528|gb|EHJ65566.1| (endonuclease-reverse transcriptase [Danaus plexippus])

HSP 1 Score: 77.0258 bits (188), Expect = 1.150e-14
Identity = 35/42 (83.33%), Postives = 36/42 (85.71%), Query Frame = 0
Query:    4 SHQLQVFVNRCLRRILGIYWPEKISNVELLERCHEIPIDQQI 45
            SH+LQVFVN CLRRILGIYWPEKISNV L ERC E PID QI
Sbjct:  690 SHRLQVFVNWCLRRILGIYWPEKISNVNLWERCGETPIDLQI 731          
BLAST of OSCA026114-RA vs. genbank:protein
Match: gi|768442692|ref|XP_011563126.1| (PREDICTED: hemicentin-1-like [Plutella xylostella])

HSP 1 Score: 66.6254 bits (161), Expect = 5.247e-11
Identity = 31/57 (54.39%), Postives = 39/57 (68.42%), Query Frame = 0
Query:    4 SHQLQVFVNRCLRRILGIYWPEKISNVELLERCHEIPIDQQITR---SSAKHKTERD 57
            + +LQVF+NRCLR+IL I+WP  ISNV+L +RCHE P+  QI R   S   H   RD
Sbjct:   76 TQKLQVFINRCLRQILKIFWPNTISNVDLWKRCHEDPVGLQIKRRKWSWIGHTLRRD 132          
BLAST of OSCA026114-RA vs. genbank:protein
Match: gi|768441692|ref|XP_011562585.1| (PREDICTED: uncharacterized protein LOC105392631 [Plutella xylostella])

HSP 1 Score: 64.3142 bits (155), Expect = 3.341e-10
Identity = 25/41 (60.98%), Postives = 34/41 (82.93%), Query Frame = 0
Query:    4 SHQLQVFVNRCLRRILGIYWPEKISNVELLERCHEIPIDQQ 44
            + +LQVF+NRCLR+IL I+WP  ISNV+L +RCHE P+D +
Sbjct:  159 TQKLQVFINRCLRQILKIFWPNTISNVDLWKRCHEDPVDYE 199          
BLAST of OSCA026114-RA vs. genbank:protein
Match: gi|732626515|gb|JAG28653.1| (Putative uncharacterized transposon-derived protein F52C9.6, partial [Lygus hesperus])

HSP 1 Score: 60.8474 bits (146), Expect = 4.682e-10
Identity = 26/44 (59.09%), Postives = 34/44 (77.27%), Query Frame = 0
Query:    4 SHQLQVFVNRCLRRILGIYWPEKISNVELLERCHEIPIDQQITR 47
            S +LQVFVNRCLRRILG++WP+ ISN ELL    ++PI  ++ R
Sbjct:    3 SRKLQVFVNRCLRRILGVWWPDTISNDELLRSTQQLPIAVEVKR 46          
BLAST of OSCA026114-RA vs. genbank:protein
Match: gi|762091931|ref|XP_011428379.1| (PREDICTED: uncharacterized protein LOC105328986 [Crassostrea gigas])

HSP 1 Score: 59.6918 bits (143), Expect = 1.502e-9
Identity = 26/51 (50.98%), Postives = 35/51 (68.63%), Query Frame = 0
Query:    1 MGSSHQLQVFVNRCLRRILGIYWPEKISNVELLERCHEIPIDQQITRSSAK 51
            M    +LQ FVN+CLR IL I+WP KI+N +L  R ++IPI Q+I +S  K
Sbjct:    1 MAKRKKLQSFVNKCLRNILQIWWPNKITNEDLWRRTNQIPIPQEIKKSKWK 51          
BLAST of OSCA026114-RA vs. genbank:protein
Match: gi|1058103321|gb|JAS55310.1| (hypothetical protein g.44847, partial [Cuerna arida])

HSP 1 Score: 59.6918 bits (143), Expect = 1.674e-9
Identity = 24/44 (54.55%), Postives = 33/44 (75.00%), Query Frame = 0
Query:    4 SHQLQVFVNRCLRRILGIYWPEKISNVELLERCHEIPIDQQITR 47
            +++LQVF+N+CLR+I  IYWPE+I+N EL+ R  E PI   I R
Sbjct:   32 NNKLQVFINKCLRKIFNIYWPERITNEELMRRAQETPIGDVIKR 75          
The following BLAST results are available for this feature:
BLAST of OSCA026114-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 12
Match NameE-valueIdentityDescription
gi|357617567|gb|EHJ70865.1|7.586e-1670.18endonuclease-reverse transcriptase [Danaus plexipp... [more]
gi|357630243|gb|EHJ78503.1|8.064e-1670.18endonuclease-reverse transcriptase [Danaus plexipp... [more]
gi|357624901|gb|EHJ75502.1|2.249e-1570.18endonuclease-reverse transcriptase [Danaus plexipp... [more]
gi|357611138|gb|EHJ67327.1|4.244e-1572.92endonuclease-reverse transcriptase [Danaus plexipp... [more]
gi|357607528|gb|EHJ65566.1|1.150e-1483.33endonuclease-reverse transcriptase [Danaus plexipp... [more]
gi|768442692|ref|XP_011563126.1|5.247e-1154.39PREDICTED: hemicentin-1-like [Plutella xylostella][more]
gi|768441692|ref|XP_011562585.1|3.341e-1060.98PREDICTED: uncharacterized protein LOC105392631 [P... [more]
gi|732626515|gb|JAG28653.1|4.682e-1059.09Putative uncharacterized transposon-derived protei... [more]
gi|762091931|ref|XP_011428379.1|1.502e-950.98PREDICTED: uncharacterized protein LOC105328986 [C... [more]
gi|1058103321|gb|JAS55310.1|1.674e-954.55hypothetical protein g.44847, partial [Cuerna arid... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0090305 nucleic acid phosphodiester bond hydrolysis
biological_process GO:0006278 RNA-dependent DNA biosynthetic process
molecular_function GO:0004519 endonuclease activity
molecular_function GO:0003964 RNA-directed DNA polymerase activity
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_11186contignewscf_11186:1505..1768 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA026114-RAOSCA026114-RAOstrinia scapulalismRNAnewscf_11186 1505..1768 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA026114-PA ID=OSCA026114-PA|Name=OSCA026114-RA|organism=Ostrinia scapulalis|type=polypeptide|length=87bp
MGSSHQLQVFVNRCLRRILGIYWPEKISNVELLERCHEIPIDQQITRSSA
KHKTERDGGLLLTPSAPSRGHRTLSQVIDGINLTFTD
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006278RNA-dependent DNA biosynthetic process
GO:0090305nucleic acid phosphodiester bond hydrolysis
Vocabulary: Molecular Function
TermDefinition
GO:0003964RNA-directed DNA polymerase activity
GO:0004519endonuclease activity