OSCA026116-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA026116-RA
Unique NameOSCA026116-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length108
Homology
BLAST of OSCA026116-RA vs. genbank:protein
Match: gi|913303362|ref|XP_013200758.1| (PREDICTED: uncharacterized protein LOC106143260 [Amyelois transitella] >gi|913311476|ref|XP_013186418.1| PREDICTED: uncharacterized protein LOC106131768 [Amyelois transitella])

HSP 1 Score: 87.4261 bits (215), Expect = 1.279e-18
Identity = 36/52 (69.23%), Postives = 41/52 (78.85%), Query Frame = 0
Query:    2 GNEEILKVSVRVPPFWPEEPALWFAQVESQFVLSGXTKDETKXYYLVAQLDH 53
            G   I KV VR+PPFWPEEPALWFAQ+E QF +SG + D TK YY+VAQLDH
Sbjct:   26 GGSNIFKVGVRIPPFWPEEPALWFAQIEGQFAISGISADNTKFYYVVAQLDH 77          
BLAST of OSCA026116-RA vs. genbank:protein
Match: gi|768434670|ref|XP_011558752.1| (PREDICTED: uncharacterized protein LOC105389351 [Plutella xylostella])

HSP 1 Score: 84.7297 bits (208), Expect = 1.411e-17
Identity = 38/50 (76.00%), Postives = 43/50 (86.00%), Query Frame = 0
Query:    5 EILKVSVRVPPFWPEEPALWFAQVESQFVLSGXTKDETKXYYLVAQLDHR 54
            EIL+V V++PPFWPEEP LWFAQVESQFVLS  T D+TK  YLVAQLDH+
Sbjct:   16 EILRVGVKIPPFWPEEPTLWFAQVESQFVLSRITTDDTKFCYLVAQLDHQ 65          
BLAST of OSCA026116-RA vs. genbank:protein
Match: gi|987899596|ref|XP_015440032.1| (PREDICTED: uncharacterized protein LOC107194838 [Dufourea novaeangliae])

HSP 1 Score: 79.337 bits (194), Expect = 1.301e-15
Identity = 30/50 (60.00%), Postives = 43/50 (86.00%), Query Frame = 0
Query:    5 EILKVSVRVPPFWPEEPALWFAQVESQFVLSGXTKDETKXYYLVAQLDHR 54
            EI +VS+R+PPFWPE+PA+WF Q+E+QF ++G T D TK YY++AQL+H+
Sbjct:   17 EINRVSIRIPPFWPEQPAVWFDQIEAQFAINGVTADTTKFYYVMAQLEHK 66          
BLAST of OSCA026116-RA vs. genbank:protein
Match: gi|512886474|ref|XP_004921763.1| (PREDICTED: uncharacterized protein LOC101742184 [Bombyx mori])

HSP 1 Score: 78.9518 bits (193), Expect = 2.475e-15
Identity = 32/50 (64.00%), Postives = 39/50 (78.00%), Query Frame = 0
Query:    5 EILKVSVRVPPFWPEEPALWFAQVESQFVLSGXTKDETKXYYLVAQLDHR 54
            E+ +V VRVPPFWPEEP +WFAQVE QF +SG T D TK  Y++ QLDH+
Sbjct:   17 ELFRVGVRVPPFWPEEPEIWFAQVEGQFAISGITSDTTKFNYVIGQLDHQ 66          
BLAST of OSCA026116-RA vs. genbank:protein
Match: gi|913312671|ref|XP_013187074.1| (PREDICTED: uncharacterized protein LOC106132260 [Amyelois transitella])

HSP 1 Score: 77.7962 bits (190), Expect = 5.699e-15
Identity = 33/49 (67.35%), Postives = 40/49 (81.63%), Query Frame = 0
Query:    6 ILKVSVRVPPFWPEEPALWFAQVESQFVLSGXTKDETKXYYLVAQLDHR 54
            I KVSVRVPPFWPEEP +WFAQVE QF +SG T D TK  Y+++QLD++
Sbjct:   34 IYKVSVRVPPFWPEEPEIWFAQVEGQFAISGITSDATKFNYVISQLDNK 82          
BLAST of OSCA026116-RA vs. genbank:protein
Match: gi|669303094|gb|KFD46718.1| (hypothetical protein M513_12428 [Trichuris suis] >gi|730368554|gb|KHJ40553.1| hypothetical protein D918_09389 [Trichuris suis])

HSP 1 Score: 70.0922 bits (170), Expect = 1.095e-13
Identity = 28/49 (57.14%), Postives = 40/49 (81.63%), Query Frame = 0
Query:    6 ILKVSVRVPPFWPEEPALWFAQVESQFVLSGXTKDETKXYYLVAQLDHR 54
            + +V+ ++PPFWP+ PALWFAQVE+QF L+G T+D TK  Y+V+QL+ R
Sbjct:   21 VHRVTAKLPPFWPDRPALWFAQVEAQFTLAGITQDATKFAYVVSQLESR 69          
BLAST of OSCA026116-RA vs. genbank:protein
Match: gi|861601944|gb|KMQ83871.1| (hypothetical protein RF55_18896 [Lasius niger])

HSP 1 Score: 72.4034 bits (176), Expect = 2.073e-13
Identity = 29/54 (53.70%), Postives = 40/54 (74.07%), Query Frame = 0
Query:    1 MGNEEILKVSVRVPPFWPEEPALWFAQVESQFVLSGXTKDETKXYYLVAQLDHR 54
            M  E+I +++V+ PPFWPEEP LWFAQ+E QF L G T+D TK  Y+V+ ++ R
Sbjct:    1 MAEEQIGRLAVKAPPFWPEEPELWFAQIEGQFTLGGITQDATKYSYVVSHIETR 54          
BLAST of OSCA026116-RA vs. genbank:protein
Match: gi|815793171|ref|XP_012217198.1| (PREDICTED: uncharacterized protein LOC105669037 [Linepithema humile])

HSP 1 Score: 73.1738 bits (178), Expect = 2.792e-13
Identity = 32/52 (61.54%), Postives = 41/52 (78.85%), Query Frame = 0
Query:    5 EILKVSVRVPPFWPEEPALWFAQVESQFVLSGXTKDETKXYYLVAQLDHRRI 56
            +I +VSVRVPPFWPEEP LWFAQ+ESQF+LS  T D TK  Y ++Q++ + I
Sbjct:   17 QIGRVSVRVPPFWPEEPELWFAQLESQFLLSAVTSDSTKYAYAISQIETKYI 68          
BLAST of OSCA026116-RA vs. genbank:protein
Match: gi|943952542|ref|XP_014359133.1| (PREDICTED: uncharacterized protein LOC106711344 [Papilio machaon])

HSP 1 Score: 73.1738 bits (178), Expect = 2.824e-13
Identity = 29/52 (55.77%), Postives = 38/52 (73.08%), Query Frame = 0
Query:    3 NEEILKVSVRVPPFWPEEPALWFAQVESQFVLSGXTKDETKXYYLVAQLDHR 54
            + +I KV +RVPPFWPEEP +WFAQ+E QF +SG   D TK  Y++ QLD +
Sbjct:   20 SSDIFKVGIRVPPFWPEEPEIWFAQIEGQFAISGIINDATKFNYVIGQLDKQ 71          
BLAST of OSCA026116-RA vs. genbank:protein
Match: gi|669326741|gb|KFD66949.1| (LOW QUALITY PROTEIN: hypothetical protein M514_20815 [Trichuris suis])

HSP 1 Score: 73.9442 bits (180), Expect = 3.431e-13
Identity = 28/47 (59.57%), Postives = 39/47 (82.98%), Query Frame = 0
Query:    8 KVSVRVPPFWPEEPALWFAQVESQFVLSGXTKDETKXYYLVAQLDHR 54
            +V+ ++PPFWP+ PALWFAQVE+QF L+G T+D TK  Y+V+QL+ R
Sbjct:   23 RVTAKLPPFWPDRPALWFAQVETQFTLAGITQDATKFAYVVSQLESR 69          
The following BLAST results are available for this feature:
BLAST of OSCA026116-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|913303362|ref|XP_013200758.1|1.279e-1869.23PREDICTED: uncharacterized protein LOC106143260 [A... [more]
gi|768434670|ref|XP_011558752.1|1.411e-1776.00PREDICTED: uncharacterized protein LOC105389351 [P... [more]
gi|987899596|ref|XP_015440032.1|1.301e-1560.00PREDICTED: uncharacterized protein LOC107194838 [D... [more]
gi|512886474|ref|XP_004921763.1|2.475e-1564.00PREDICTED: uncharacterized protein LOC101742184 [B... [more]
gi|913312671|ref|XP_013187074.1|5.699e-1567.35PREDICTED: uncharacterized protein LOC106132260 [A... [more]
gi|669303094|gb|KFD46718.1|1.095e-1357.14hypothetical protein M513_12428 [Trichuris suis] >... [more]
gi|861601944|gb|KMQ83871.1|2.073e-1353.70hypothetical protein RF55_18896 [Lasius niger][more]
gi|815793171|ref|XP_012217198.1|2.792e-1361.54PREDICTED: uncharacterized protein LOC105669037 [L... [more]
gi|943952542|ref|XP_014359133.1|2.824e-1355.77PREDICTED: uncharacterized protein LOC106711344 [P... [more]
gi|669326741|gb|KFD66949.1|3.431e-1359.57LOW QUALITY PROTEIN: hypothetical protein M514_208... [more]

Pages

back to top
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 1..55
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 76..108
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 56..75

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_2066contignewscf_2066:2955..3281 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA026116-RAOSCA026116-RAOstrinia scapulalismRNAnewscf_2066 2955..3281 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA026116-PA ID=OSCA026116-PA|Name=OSCA026116-RA|organism=Ostrinia scapulalis|type=polypeptide|length=108bp
MGNEEILKVSVRVPPFWPEEPALWFAQVESQFVLSGXTKDETKXYYLVAQ
LDHRRILGYIAAALIFRLSLCVWPWREVSTDKGCLVLKNLFDYSIVNAKH
NIGEKEKS
back to top