OSCA026118-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA026118-RA
Unique NameOSCA026118-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length100
Homology
BLAST of OSCA026118-RA vs. genbank:protein
Match: gi|512935605|ref|XP_004933314.1| (PREDICTED: uncharacterized protein LOC101739238 [Bombyx mori])

HSP 1 Score: 75.485 bits (184), Expect = 9.555e-16
Identity = 40/55 (72.73%), Postives = 41/55 (74.55%), Query Frame = 0
Query:   26 DFYNDRSCAARIQALPATFTRSSVHLVGGLPTLRLPARGRHSRTYLPQRPSSLCA 80
            DF  DRS A  IQ  PA F RSSVHLVGG PTLRLP RGRHSR +LP RPSSL A
Sbjct:   48 DFQCDRSIATCIQRDPALFIRSSVHLVGGRPTLRLPVRGRHSRIFLPHRPSSLRA 102          
BLAST of OSCA026118-RA vs. genbank:protein
Match: gi|930665739|gb|KPJ06866.1| (hypothetical protein RR48_11365 [Papilio machaon])

HSP 1 Score: 77.0258 bits (188), Expect = 1.492e-14
Identity = 43/77 (55.84%), Postives = 49/77 (63.64%), Query Frame = 0
Query:    4 GTHSHIRSSPNDVHCW--TKAYPKDFYNDRSCAARIQALPATFTRSSVHLVGGLPTLRLPARGRHSRTYLPQRPSSL 78
             T S + ++P     W  + A PKD ++D SCA RIQ  PAT TRSSVHL GGL TLR P RGRHS T  P RPS L
Sbjct:  170 ATGSPVHAAPESGTRWMISVASPKDRHDDGSCATRIQDTPATLTRSSVHLAGGLRTLRQPVRGRHSSTLRPHRPSIL 246          
The following BLAST results are available for this feature:
BLAST of OSCA026118-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 2
Match NameE-valueIdentityDescription
gi|512935605|ref|XP_004933314.1|9.555e-1672.73PREDICTED: uncharacterized protein LOC101739238 [B... [more]
gi|930665739|gb|KPJ06866.1|1.492e-1455.84hypothetical protein RR48_11365 [Papilio machaon][more]
back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_28854contignewscf_28854:787..1089 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA026118-RAOSCA026118-RAOstrinia scapulalismRNAnewscf_28854 787..1089 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA026118-PA ID=OSCA026118-PA|Name=OSCA026118-RA|organism=Ostrinia scapulalis|type=polypeptide|length=100bp
MPNGTHSHIRSSPNDVHCWTKAYPKDFYNDRSCAARIQALPATFTRSSVH
LVGGLPTLRLPARGRHSRTYLPQRPSSLCAPPTEWHYVRLMYSVLCAYNF
back to top