OSCA026119-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA026119-RA
Unique NameOSCA026119-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length131
Homology
BLAST of OSCA026119-RA vs. genbank:protein
Match: gi|913317895|ref|XP_013189952.1| (PREDICTED: septin-interacting protein 1 [Amyelois transitella])

HSP 1 Score: 228.409 bits (581), Expect = 3.306e-68
Identity = 107/132 (81.06%), Postives = 124/132 (93.94%), Query Frame = 0
Query:    1 KMFPEEVLKEPAVRDAFRKALDMLNRSTDIDSVEPPPPPRFT-SEPKETSRIADVLASTTQQKSFSELLEARCLERGVTLVPIAGKSREGRPLYRVGNMQCYVIRNVVMYSADNGRTFGPISMDRLLSLAED 131
            KMFPEEVLKEPAVRDAFRKALDM+NRSTDI++VEPPPPPRFT +E KETSRIADVLASTT QKSFSELLE+RC+E+G+T VPIAGK+REGRPLY++G+MQCYVIRNV+MYS D GRTF PIS++RLL++ ED
Sbjct:  645 KMFPEEVLKEPAVRDAFRKALDMMNRSTDIETVEPPPPPRFTVTETKETSRIADVLASTTSQKSFSELLESRCVEKGITFVPIAGKNREGRPLYKIGDMQCYVIRNVIMYSED-GRTFSPISIERLLNMVED 775          
BLAST of OSCA026119-RA vs. genbank:protein
Match: gi|768435156|ref|XP_011559011.1| (PREDICTED: septin-interacting protein 1 [Plutella xylostella])

HSP 1 Score: 219.935 bits (559), Expect = 5.055e-65
Identity = 105/133 (78.95%), Postives = 116/133 (87.22%), Query Frame = 0
Query:    1 KMFPEEVLKEPAVRDAFRKALDMLNRSTDIDSVEPPPPPRFTS-EPKETSRIADVLASTTQQKSFSELLEARCLERGVTLVPIAGKSREGRPLYRVG-NMQCYVIRNVVMYSADNGRTFGPISMDRLLSLAED 131
            KMFPEEVLKEPAVRDAFRKALDM+NRS DIDSVE PPPPRFT  EPKE SRIADVL ST Q KSFSELLE RC+E G+T VP+ GK REGRP+YR+G +MQCYVIRNV+MYS+D+GR F PIS+DRLL LAED
Sbjct:  652 KMFPEEVLKEPAVRDAFRKALDMMNRSADIDSVEAPPPPRFTMPEPKEVSRIADVLGSTNQTKSFSELLETRCVENGITFVPLPGKLREGRPIYRIGASMQCYVIRNVIMYSSDSGRVFAPISLDRLLKLAED 784          
BLAST of OSCA026119-RA vs. genbank:protein
Match: gi|1073526431|gb|JAT80327.1| (hypothetical protein g.6387, partial [Pectinophora gossypiella])

HSP 1 Score: 200.29 bits (508), Expect = 1.127e-63
Identity = 96/132 (72.73%), Postives = 119/132 (90.15%), Query Frame = 0
Query:    1 KMFPEEVLKEPAVRDAFRKALDMLNRSTDIDSVEPPPPPRFTS-EPKETSRIADVLASTTQQKSFSELLEARCLERGVTLVPIAGKSREGRPLYRVGNMQCYVIRNVVMYSADNGRTFGPISMDRLLSLAED 131
            KMFPEEVLKE AVRDAFRKALDM+NRSTD++ VEPPPPPRFT+ EPKE+++I+++LA+TTQ KSFSELLE++C+E+G+T VPI GKSREGRPLY++G MQCYVIRNV+MYS D GRTF P+ +D+LL + ED
Sbjct:   33 KMFPEEVLKEAAVRDAFRKALDMMNRSTDMECVEPPPPPRFTAPEPKESTKISEILATTTQHKSFSELLESKCVEKGITFVPIPGKSREGRPLYKIGTMQCYVIRNVIMYSDDGGRTFLPVGLDKLLKMVED 164          
BLAST of OSCA026119-RA vs. genbank:protein
Match: gi|357624561|gb|EHJ75286.1| (septin and tuftelin interacting protein [Danaus plexippus])

HSP 1 Score: 215.698 bits (548), Expect = 1.594e-63
Identity = 106/132 (80.30%), Postives = 121/132 (91.67%), Query Frame = 0
Query:    1 KMFPEEVLKEPAVRDAFRKALDMLNRSTDIDSVEPPPPPRFT-SEPKETSRIADVLASTTQQKSFSELLEARCLERGVTLVPIAGKSREGRPLYRVGNMQCYVIRNVVMYSADNGRTFGPISMDRLLSLAED 131
            KMFPE+VLKEP VRDAFRKALDM+NRSTDIDS+EPPPPPRFT  EPKE+SRI+DVLA+ TQQKSFSELLE+RC+ERG+T VPI GKSREGRPLY++G +QCYVIRNV+MYS D GR+FGPI +DRLLSL ED
Sbjct:  641 KMFPEDVLKEPPVRDAFRKALDMMNRSTDIDSIEPPPPPRFTIPEPKESSRISDVLATITQQKSFSELLESRCIERGITFVPIVGKSREGRPLYKIGELQCYVIRNVIMYSDDGGRSFGPIGLDRLLSLVED 772          
BLAST of OSCA026119-RA vs. genbank:protein
Match: gi|914570124|gb|KOB73587.1| (Septin and tuftelin interacting protein, partial [Operophtera brumata])

HSP 1 Score: 210.69 bits (535), Expect = 3.865e-62
Identity = 96/129 (74.42%), Postives = 114/129 (88.37%), Query Frame = 0
Query:    1 KMFPEEVLKEPAVRDAFRKALDMLNRSTDIDSVEPPPPPRFT-SEPKETSRIADVLASTTQQKSFSELLEARCLERGVTLVPIAGKSREGRPLYRVGNMQCYVIRNVVMYSADNGRTFGPISMDRLLSL 128
            K+FPEEVL+EP VRD+FRKALDM+NRSTDID+VE PPPPRFT  + KETSRIAD LAS TQQKSFSELLE+RC+E+G+T VP+ GK+REGRP+Y++G+ QCYVIRNV+MYS D GR F PISMDRLL +
Sbjct:  519 KLFPEEVLREPVVRDSFRKALDMMNRSTDIDTVEAPPPPRFTPVDIKETSRIADALASATQQKSFSELLESRCVEKGITFVPLVGKNREGRPIYKIGDKQCYVIRNVIMYSDDAGRNFAPISMDRLLKM 647          
BLAST of OSCA026119-RA vs. genbank:protein
Match: gi|827558127|ref|XP_012550229.1| (PREDICTED: septin and tuftelin interacting protein isoform X2 [Bombyx mori])

HSP 1 Score: 206.068 bits (523), Expect = 5.484e-60
Identity = 100/133 (75.19%), Postives = 117/133 (87.97%), Query Frame = 0
Query:    1 KMFPEEVLKEPAVRDAFRKALDMLNRSTDIDSVEPPPPPRFT--SEPKETSRIADVLASTTQQKSFSELLEARCLERGVTLVPIAGKSREGRPLYRVGNMQCYVIRNVVMYSADNGRTFGPISMDRLLSLAED 131
            KMFPE++LKEPAVRDAFRKALDM+NRS DID+++PPPPPRFT  +E KET RI DVLAS TQQKSFSELLE RC+E G+T VPIAGK+REGRPLY++G +QCYVIRNV+MYS DNGR F PI++D+LL L ED
Sbjct:  642 KMFPEDILKEPAVRDAFRKALDMMNRSADIDTIDPPPPPRFTVITETKETPRIVDVLASATQQKSFSELLETRCIENGITFVPIAGKTREGRPLYKIGALQCYVIRNVIMYSDDNGRNFAPIAIDKLLKLVED 774          
BLAST of OSCA026119-RA vs. genbank:protein
Match: gi|827558125|ref|XP_012550228.1| (PREDICTED: septin and tuftelin interacting protein isoform X1 [Bombyx mori])

HSP 1 Score: 206.068 bits (523), Expect = 5.550e-60
Identity = 100/133 (75.19%), Postives = 117/133 (87.97%), Query Frame = 0
Query:    1 KMFPEEVLKEPAVRDAFRKALDMLNRSTDIDSVEPPPPPRFT--SEPKETSRIADVLASTTQQKSFSELLEARCLERGVTLVPIAGKSREGRPLYRVGNMQCYVIRNVVMYSADNGRTFGPISMDRLLSLAED 131
            KMFPE++LKEPAVRDAFRKALDM+NRS DID+++PPPPPRFT  +E KET RI DVLAS TQQKSFSELLE RC+E G+T VPIAGK+REGRPLY++G +QCYVIRNV+MYS DNGR F PI++D+LL L ED
Sbjct:  644 KMFPEDILKEPAVRDAFRKALDMMNRSADIDTIDPPPPPRFTVITETKETPRIVDVLASATQQKSFSELLETRCIENGITFVPIAGKTREGRPLYKIGALQCYVIRNVIMYSDDNGRNFAPIAIDKLLKLVED 776          
BLAST of OSCA026119-RA vs. genbank:protein
Match: gi|148298831|ref|NP_001091840.1| (septin and tuftelin interacting protein [Bombyx mori] >gi|85363120|gb|ABC69938.1| STIP [Bombyx mori])

HSP 1 Score: 205.682 bits (522), Expect = 8.404e-60
Identity = 100/133 (75.19%), Postives = 117/133 (87.97%), Query Frame = 0
Query:    1 KMFPEEVLKEPAVRDAFRKALDMLNRSTDIDSVEPPPPPRFT--SEPKETSRIADVLASTTQQKSFSELLEARCLERGVTLVPIAGKSREGRPLYRVGNMQCYVIRNVVMYSADNGRTFGPISMDRLLSLAED 131
            KMFPE++LKEPAVRDAFRKALDM+NRS DID+++PPPPPRFT  +E KET RI DVLAS TQQKSFSELLE RC+E G+T VPIAGK+REGRPLY++G +QCYVIRNV+MYS DNGR F PI++D+LL L ED
Sbjct:  650 KMFPEDILKEPAVRDAFRKALDMMNRSADIDTIDPPPPPRFTVITETKETPRIVDVLASATQQKSFSELLETRCIENGITFVPIAGKTREGRPLYKIGALQCYVIRNVIMYSDDNGRNFAPIAIDKLLKLVED 782          
BLAST of OSCA026119-RA vs. genbank:protein
Match: gi|930656397|gb|KPI98721.1| (Septin-interacting protein 1 [Papilio xuthus])

HSP 1 Score: 193.741 bits (491), Expect = 8.826e-60
Identity = 95/132 (71.97%), Postives = 115/132 (87.12%), Query Frame = 0
Query:    1 KMFPEEVLKEPAVRDAFRKALDMLNRSTDIDSVEPPPPPRFT-SEPKETSRIADVLASTTQQKSFSELLEARCLERGVTLVPIAGKSREGRPLYRVGNMQCYVIRNVVMYSADNGRTFGPISMDRLLSLAED 131
            KMFPEEVLKEPAVRDAFRKALDM+NRSTD++SVEPPPPPRFT  + KE S+I ++LA T   KSFSELLE +C+E+G+T VPI GK+REGRPLY++G MQCYVIRNV+M+S D GR+FGPI MDRLL++ E+
Sbjct:  131 KMFPEEVLKEPAVRDAFRKALDMMNRSTDMESVEPPPPPRFTLPDNKEGSKINEILAVTNPHKSFSELLETKCIEKGITFVPIPGKTREGRPLYKIGRMQCYVIRNVIMFSEDGGRSFGPIGMDRLLNMVEE 262          
BLAST of OSCA026119-RA vs. genbank:protein
Match: gi|943941905|ref|XP_014372302.1| (PREDICTED: septin-interacting protein 1 [Papilio machaon])

HSP 1 Score: 201.06 bits (510), Expect = 2.729e-58
Identity = 99/132 (75.00%), Postives = 115/132 (87.12%), Query Frame = 0
Query:    1 KMFPEEVLKEPAVRDAFRKALDMLNRSTDIDSVEPPPPPRFT-SEPKETSRIADVLASTTQQKSFSELLEARCLERGVTLVPIAGKSREGRPLYRVGNMQCYVIRNVVMYSADNGRTFGPISMDRLLSLAED 131
            KMFPEEVLKEPAVRDAFRKALDM+NRSTDID+VEPPPPPRFT  + KE S+I D+LA T   KSFSELLE RC+E+G+T VPI GK+REGRPLY++G MQCYVIRNV+MYS D GR+FGPI MDRLL++ E+
Sbjct:  602 KMFPEEVLKEPAVRDAFRKALDMMNRSTDIDTVEPPPPPRFTLPDTKEVSKINDILAVTNPHKSFSELLETRCIEKGITFVPIPGKTREGRPLYKIGAMQCYVIRNVIMYSEDGGRSFGPIGMDRLLNMVEE 733          
The following BLAST results are available for this feature:
BLAST of OSCA026119-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|913317895|ref|XP_013189952.1|3.306e-6881.06PREDICTED: septin-interacting protein 1 [Amyelois ... [more]
gi|768435156|ref|XP_011559011.1|5.055e-6578.95PREDICTED: septin-interacting protein 1 [Plutella ... [more]
gi|1073526431|gb|JAT80327.1|1.127e-6372.73hypothetical protein g.6387, partial [Pectinophora... [more]
gi|357624561|gb|EHJ75286.1|1.594e-6380.30septin and tuftelin interacting protein [Danaus pl... [more]
gi|914570124|gb|KOB73587.1|3.865e-6274.42Septin and tuftelin interacting protein, partial [... [more]
gi|827558127|ref|XP_012550229.1|5.484e-6075.19PREDICTED: septin and tuftelin interacting protein... [more]
gi|827558125|ref|XP_012550228.1|5.550e-6075.19PREDICTED: septin and tuftelin interacting protein... [more]
gi|148298831|ref|NP_001091840.1|8.404e-6075.19septin and tuftelin interacting protein [Bombyx mo... [more]
gi|930656397|gb|KPI98721.1|8.826e-6071.97Septin-interacting protein 1 [Papilio xuthus][more]
gi|943941905|ref|XP_014372302.1|2.729e-5875.00PREDICTED: septin-interacting protein 1 [Papilio m... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006355 regulation of transcription, DNA-templated
cellular_component GO:0005634 nucleus
molecular_function GO:0003677 DNA binding
InterPro
Analysis Name: InterProScan: Annotation v1.2
Date Performed: 2017-06-22
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR23329TUFTELIN-INTERACTING PROTEIN 11-RELATEDcoord: 2..131

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_20790contignewscf_20790:2102..2497 -
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
InterProScan: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA026119-RAOSCA026119-RAOstrinia scapulalismRNAnewscf_20790 2102..2497 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA026119-PA ID=OSCA026119-PA|Name=OSCA026119-RA|organism=Ostrinia scapulalis|type=polypeptide|length=131bp
KMFPEEVLKEPAVRDAFRKALDMLNRSTDIDSVEPPPPPRFTSEPKETSR
IADVLASTTQQKSFSELLEARCLERGVTLVPIAGKSREGRPLYRVGNMQC
YVIRNVVMYSADNGRTFGPISMDRLLSLAED
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0005634nucleus
Vocabulary: Molecular Function
TermDefinition
GO:0003677DNA binding
Vocabulary: Biological Process
TermDefinition
GO:0006355regulation of transcription, DNA-templated