OSCA026120-PA (polypeptide) Ostrinia scapulalis

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameOSCA026120-RA
Unique NameOSCA026120-PA
Typepolypeptide
OrganismOstrinia scapulalis (Adzuki bean borer)
Sequence length127
Homology
BLAST of OSCA026120-RA vs. genbank:protein
Match: gi|930679416|gb|KPJ19282.1| (Latrophilin Cirl [Papilio machaon])

HSP 1 Score: 138.272 bits (347), Expect = 2.196e-35
Identity = 102/123 (82.93%), Postives = 108/123 (87.80%), Query Frame = 0
Query:    1 STASTSVSASTTNNLVINNLNVVVNNNNHNNNNVINNAAVASLAAAAAAHSYHSHRNRRNSQENQSFGPPSNFGPTLNATAAGFPHNIPERE-AAPMSHLRNPINPGSGRYPQGYRQNVQQGA 122
            S+ +TSV+ASTTNNLVIN LNVVVNNNNHNNNNVINNAAVASLAAAAAAH+YH HRNRRNSQENQSF P SNFGPTLNAT A F HNIPERE  A M+HLR P+N GSGRYP GYRQNVQQG 
Sbjct: 1149 SSTNTSVAASTTNNLVINTLNVVVNNNNHNNNNVINNAAVASLAAAAAAHNYHPHRNRRNSQENQSFSPSSNFGPTLNATGANFSHNIPEREPPAAMTHLRGPLNQGSGRYPPGYRQNVQQGC 1271          
BLAST of OSCA026120-RA vs. genbank:protein
Match: gi|930664501|gb|KPJ05809.1| (Latrophilin Cirl [Papilio xuthus])

HSP 1 Score: 136.732 bits (343), Expect = 7.567e-35
Identity = 101/123 (82.11%), Postives = 109/123 (88.62%), Query Frame = 0
Query:    1 STASTSVSASTTNNLVINNLNVVVNNNNHNNNNVINNAAVASLAAAAAAHSYHSHRNRRNSQENQSFGPPSNFGPTLNATAAGFPHNIPERE-AAPMSHLRNPINPGSGRYPQGYRQNVQQGA 122
            S+ +TSV+ASTTNNLVIN LNVVVNNNNHNNNNVINNAAVASLAAAAAAH+YHSHRNRRNSQENQ+F P SNFGPTLNAT A F HNIPER+  A M+HLR P+N GSGRYP GYRQNVQQG 
Sbjct: 1006 SSTNTSVAASTTNNLVINTLNVVVNNNNHNNNNVINNAAVASLAAAAAAHNYHSHRNRRNSQENQNFSPSSNFGPTLNATGANFSHNIPERDPPAAMTHLRGPLNQGSGRYPPGYRQNVQQGC 1128          
BLAST of OSCA026120-RA vs. genbank:protein
Match: gi|910342065|ref|XP_013174761.1| (PREDICTED: latrophilin Cirl isoform X3 [Papilio xuthus])

HSP 1 Score: 136.346 bits (342), Expect = 1.232e-34
Identity = 101/121 (83.47%), Postives = 108/121 (89.26%), Query Frame = 0
Query:    1 STASTSVSASTTNNLVINNLNVVVNNNNHNNNNVINNAAVASLAAAAAAHSYHSHRNRRNSQENQSFGPPSNFGPTLNATAAGFPHNIPERE-AAPMSHLRNPINPGSGRYPQGYRQNVQQ 120
            S+ +TSV+ASTTNNLVIN LNVVVNNNNHNNNNVINNAAVASLAAAAAAH+YHSHRNRRNSQENQ+F P SNFGPTLNAT A F HNIPERE  A M+HLR P+N GSGRYP GYRQNVQQ
Sbjct: 1177 SSTNTSVAASTTNNLVINTLNVVVNNNNHNNNNVINNAAVASLAAAAAAHNYHSHRNRRNSQENQNFSPSSNFGPTLNATGANFSHNIPEREPPAAMTHLRGPLNQGSGRYPPGYRQNVQQ 1297          
BLAST of OSCA026120-RA vs. genbank:protein
Match: gi|909554789|ref|XP_013148877.1| (PREDICTED: latrophilin Cirl isoform X2 [Papilio polytes])

HSP 1 Score: 134.42 bits (337), Expect = 5.071e-34
Identity = 100/121 (82.64%), Postives = 107/121 (88.43%), Query Frame = 0
Query:    1 STASTSVSASTTNNLVINNLNVVVNNNNHNNNNVINNAAVASLAAAAAAHSYHSHRNRRNSQENQSFGPPSNFGPTLNATAAGFPHNIPERE-AAPMSHLRNPINPGSGRYPQGYRQNVQQ 120
            S+ +TSV+ASTTNNLVIN LNVVVNNNNHNNNNVINNAAVASLAAAAAAH+YH HRNRRNSQENQSFG  SNFGPTLNAT A F HN+PERE  A M+HLR P+N GSGRYP GYRQNVQQ
Sbjct: 1163 SSTNTSVAASTTNNLVINTLNVVVNNNNHNNNNVINNAAVASLAAAAAAHNYHPHRNRRNSQENQSFGTSSNFGPTLNATGANFSHNMPEREPPAAMTHLRGPLNQGSGRYPPGYRQNVQQ 1283          
BLAST of OSCA026120-RA vs. genbank:protein
Match: gi|357604184|gb|EHJ64078.1| (latrophilin-like receptor [Danaus plexippus])

HSP 1 Score: 128.257 bits (321), Expect = 2.898e-32
Identity = 99/120 (82.50%), Postives = 112/120 (93.33%), Query Frame = 0
Query:    2 TASTSVSASTTNNLVINNLNVVVNNNNHNNNNVINNAAVASLAAAAAAHSYHSHRNRRNSQENQSFGPPSNFGPTLNATAAGFPHNIPERE-AAPMSHLRNPINPGSGRYPQGYRQNVQQ 120
            +ASTSVSAS TNNLVINNLNVVVNNNNHNNNNVINN++VA+LAAAAAAHSY  HRNRRNSQENQSFGP ++FGPTLNA ++ FPHN+P+RE +APM+HLRNP+N GSGRYPQGYRQNVQQ
Sbjct:  365 SASTSVSASMTNNLVINNLNVVVNNNNHNNNNVINNSSVATLAAAAAAHSY--HRNRRNSQENQSFGPSTSFGPTLNA-SSNFPHNLPDREPSAPMTHLRNPLNHGSGRYPQGYRQNVQQ 481          
BLAST of OSCA026120-RA vs. genbank:protein
Match: gi|914573128|gb|KOB75762.1| (Latrophilin-like receptor [Operophtera brumata])

HSP 1 Score: 123.25 bits (308), Expect = 4.108e-30
Identity = 96/123 (78.05%), Postives = 103/123 (83.74%), Query Frame = 0
Query:    1 STASTSVSASTTNNLVINNLNVVVNNNNHNNNNVINNAAVASLAAAAAAHSYHSHRNRRNSQENQSFGPPSNFGPTLNATAAGFPHNIPEREAAPMSHLRNPINPGSGRYPQGYRQNVQQGAY 123
            ST+  S SASTTNNLVIN LNVVVNNNNHNNNNVINNAAVASLAAAAAAHSYHS+RNRR SQENQ+F   SNFGP+LNATAA FPHN+     APM+HLRNPIN GSGRYPQGYR   QQ  +
Sbjct:  797 STSGMSASASTTNNLVINTLNVVVNNNNHNNNNVINNAAVASLAAAAAAHSYHSNRNRRTSQENQNFA--SNFGPSLNATAASFPHNVEREPPAPMTHLRNPINTGSGRYPQGYRPQGQQVIF 917          
BLAST of OSCA026120-RA vs. genbank:protein
Match: gi|768417047|ref|XP_011549138.1| (PREDICTED: latrophilin Cirl isoform X4 [Plutella xylostella])

HSP 1 Score: 115.931 bits (289), Expect = 1.331e-27
Identity = 81/92 (88.04%), Postives = 86/92 (93.48%), Query Frame = 0
Query:   29 HNNNNVINNAAVASLAAAAAAHSYHSHRNRRNSQENQSFGPPSNFGPTLNATAAGFPHNIPEREAAPMSHLRNPINPGSGRYPQGYRQNVQQ 120
            HNNNNVINN+AVASLAAAAAAHSYH+HRNRRNSQENQ+F PPSNFGPTLNATAA F HN  ER+AAPMSHLRNP+N GSGRYPQGYRQNVQQ
Sbjct: 1210 HNNNNVINNSAVASLAAAAAAHSYHTHRNRRNSQENQNF-PPSNFGPTLNATAASFGHN--ERDAAPMSHLRNPMNSGSGRYPQGYRQNVQQ 1298          
The following BLAST results are available for this feature:
BLAST of OSCA026120-RA vs. genbank:protein
Analysis Date: 2017-06-22 (Blastp: Annotation v1.2 vs NR)
Total hits: 7
Match NameE-valueIdentityDescription
gi|930679416|gb|KPJ19282.1|2.196e-3582.93Latrophilin Cirl [Papilio machaon][more]
gi|930664501|gb|KPJ05809.1|7.567e-3582.11Latrophilin Cirl [Papilio xuthus][more]
gi|910342065|ref|XP_013174761.1|1.232e-3483.47PREDICTED: latrophilin Cirl isoform X3 [Papilio xu... [more]
gi|909554789|ref|XP_013148877.1|5.071e-3482.64PREDICTED: latrophilin Cirl isoform X2 [Papilio po... [more]
gi|357604184|gb|EHJ64078.1|2.898e-3282.50latrophilin-like receptor [Danaus plexippus][more]
gi|914573128|gb|KOB75762.1|4.108e-3078.05Latrophilin-like receptor [Operophtera brumata][more]
gi|768417047|ref|XP_011549138.1|1.331e-2788.04PREDICTED: latrophilin Cirl isoform X4 [Plutella x... [more]
back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0007166 cell surface receptor signaling pathway
biological_process GO:0007186 G-protein coupled receptor signaling pathway
cellular_component GO:0016021 integral component of membrane
molecular_function GO:0030246 carbohydrate binding
molecular_function GO:0004930 G-protein coupled receptor activity
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
newscf_18218contignewscf_18218:997..1380 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Blast2GO: Annotation v1.22017-06-22
Blastp: Annotation v1.2 vs NR2017-06-22
Whole Genome Assembly (v1.2) and Annotation (v1.2) of Ostrinia scapulalis2017-06-22
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
OSCA026120-RAOSCA026120-RAOstrinia scapulalismRNAnewscf_18218 997..1380 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>OSCA026120-PA ID=OSCA026120-PA|Name=OSCA026120-RA|organism=Ostrinia scapulalis|type=polypeptide|length=127bp
STASTSVSASTTNNLVINNLNVVVNNNNHNNNNVINNAAVASLAAAAAAH
SYHSHRNRRNSQENQSFGPPSNFGPTLNATAAGFPHNIPEREAAPMSHLR
NPINPGSGRYPQGYRQNVQQGAYALLR
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0030246carbohydrate binding
Vocabulary: Biological Process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007166cell surface receptor signaling pathway
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane