Cotesia_rubecula011001-PA (polypeptide) Cotesia rubecula

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameCotesia_rubecula011001-RA
Unique NameCotesia_rubecula011001-PA
Typepolypeptide
OrganismCotesia rubecula (Cotesia rubecula)
Sequence length479
Homology
BLAST of Cotesia_rubecula011001-RA vs. genbank:protein
Match: gi|665808679|ref|XP_008552672.1| (PREDICTED: synaptic vesicular amine transporter [Microplitis demolitor])

HSP 1 Score: 918.302 bits (2372), Expect = 0.000e+0
Identity = 449/477 (94.13%), Postives = 462/477 (96.86%), Query Frame = 0
Query:    3 VPIIPEFLYDIKHPNNTLSQHLDGPHYTTRPMTIASIISTPIPPTKCTCPQVNASNNGQLEFLQATTGAPVSIVNGSTIMVPI-NTTSLEDLEKSQRHKELLEETVAVGIMFASKAFVQLLANPIVGPLTHKIGYSVPMFAGFVIMFVSTLIFAFGRSYSVLFIARALQGIGSSCSTVSGMGMLAERYQDDKERGNAMGIALGGLALGVLIGPPFGGLMYEFVGKSAPFLALSVLALGDGLLQLLMLQPTVVYTETASPSLKALVTDPYIIVAAGAITFANMGIAMLEPSLPIWMMDTMGASRWKQGATFLPASISYLIGTNLFGPLGHRMGRWLASLVGLIVIGFCLMCIPLATNINHLIMPNAGLGFAIGMVDSSMMPELGYLVDIRHTAVYGSVYAIGDVAFCLGYVVGPALSGTLVNTIGFEWMLFGTAMLCFMYAPLMYFLKSPPTKEEKKSLIIGEKSSVRYVSYENEEEE 478
            VPIIPEFLYDIKHPNNTLSQHLDGPHYTTRPMTIASIISTPIPPTKCTCPQ+NASN+GQLEFLQ  T       NGS + VP  N TSLE+LEK+QRH+ELLEETVAVGIMFASKAFVQLLANPIVGPLTHKIGYSVPMFAGFVIMF+STL+FAFGRSYSVLFIARALQGIGSSCSTVSGMGMLAERYQDDKERGNAMGIALGGLALGVLIGPPFGGLMYEFVGKSAPFLALSVLALGDGLLQLLMLQPTVVYTETASPSLKAL+TDPYIIVAAGAITFANMGIAMLEPSLPIWMMDTMGASRWKQGATFLPASISYLIGTNLFGPLGHRMGRWLA+LVGLIVIGFCLM IPLATNINHLIMPNAGLGFAIGMVDSSMMPELGYLVDIRHTAVYGSVYAIGDVAFCLGYVVGPALSGTLVNTIGFEWMLFGTAMLCF+YAPLMYFLK+PPTKEEKKSLIIGEKSSVRYVSYEN+EEE
Sbjct:   40 VPIIPEFLYDIKHPNNTLSQHLDGPHYTTRPMTIASIISTPIPPTKCTCPQINASNSGQLEFLQLVTSTSSPNGNGSIVNVPTTNATSLENLEKAQRHRELLEETVAVGIMFASKAFVQLLANPIVGPLTHKIGYSVPMFAGFVIMFISTLVFAFGRSYSVLFIARALQGIGSSCSTVSGMGMLAERYQDDKERGNAMGIALGGLALGVLIGPPFGGLMYEFVGKSAPFLALSVLALGDGLLQLLMLQPTVVYTETASPSLKALITDPYIIVAAGAITFANMGIAMLEPSLPIWMMDTMGASRWKQGATFLPASISYLIGTNLFGPLGHRMGRWLAALVGLIVIGFCLMLIPLATNINHLIMPNAGLGFAIGMVDSSMMPELGYLVDIRHTAVYGSVYAIGDVAFCLGYVVGPALSGTLVNTIGFEWMLFGTAMLCFLYAPLMYFLKAPPTKEEKKSLIIGEKSSVRYVSYENDEEE 516          
BLAST of Cotesia_rubecula011001-RA vs. genbank:protein
Match: gi|972198634|ref|XP_015181296.1| (PREDICTED: synaptic vesicular amine transporter [Polistes dominula] >gi|972198636|ref|XP_015181297.1| PREDICTED: synaptic vesicular amine transporter [Polistes dominula] >gi|972198638|ref|XP_015181298.1| PREDICTED: synaptic vesicular amine transporter [Polistes dominula])

HSP 1 Score: 789.26 bits (2037), Expect = 0.000e+0
Identity = 389/480 (81.04%), Postives = 431/480 (89.79%), Query Frame = 0
Query:    3 VPIIPEFLYDIKHPNNTLSQHLDGPHYT---TRPMTIASIISTPIPPT-KCTCPQVNASNNGQLEFLQATTGAPVSIVNGSTIMVPINTTSLEDLEKSQRHKELLEETVAVGIMFASKAFVQLLANPIVGPLTHKIGYSVPMFAGFVIMFVSTLIFAFGRSYSVLFIARALQGIGSSCSTVSGMGMLAERYQDDKERGNAMGIALGGLALGVLIGPPFGGLMYEFVGKSAPFLALSVLALGDGLLQLLMLQPTVVYTETASPSLKALVTDPYIIVAAGAITFANMGIAMLEPSLPIWMMDTMGASRWKQGATFLPASISYLIGTNLFGPLGHRMGRWLASLVGLIVIGFCLMCIPLATNINHLIMPNAGLGFAIGMVDSSMMPELGYLVDIRHTAVYGSVYAIGDVAFCLGYVVGPALSGTLVNTIGFEWMLFGTAMLCFMYAPLMYFLKSPPTKEEKKSLIIGEKSSVRYVSYENEEEE 478
            VPIIPEFLYDI+HPN+TLS+HL+G +     T   T+ +  S   PPT +C+CP  N SNN QLEFL  TT +   + + +TI    N T  E  +K QRHKELLEETVAVG+MFASKAFVQLLANP+VGPLTH+IGYS+PMF GF+IMF+STLIFAFGRSY +LF+ARALQGIGSSCS+VSGMGMLAERYQDDKERGNAMGIALGGLALGVLIGPPFGG+MYEFVGKSAPFL LS LALGDGLLQLLMLQP+VVYTE   PSLK+LVTDPYII+AAGAITFANMGIAMLEPSLPIWMMDTMGASRWKQGATFLPASISYLIGTNLFGPLGHRMGRWLASL+GL+VIG CLMCIPLAT+INHLI+PNAGLGFAIGMVDSSMMPELGYLVDIRH+AVYGSVYAIGDVAFCLG+ +GPALSGTLVNTIGFEWMLFG A+L F+YAPLMYFL++PPTKEEKKSLIIGEKSSVRYV+Y+NEE++
Sbjct:   39 VPIIPEFLYDIRHPNSTLSEHLEGNYRAEVITTTTTMTTSTSPITPPTPRCSCPCNNTSNNSQLEFLSGTTMS-AELTDSTTI----NATMAELEQKEQRHKELLEETVAVGMMFASKAFVQLLANPVVGPLTHRIGYSIPMFTGFIIMFISTLIFAFGRSYGILFMARALQGIGSSCSSVSGMGMLAERYQDDKERGNAMGIALGGLALGVLIGPPFGGVMYEFVGKSAPFLVLSALALGDGLLQLLMLQPSVVYTEAEPPSLKSLVTDPYIILAAGAITFANMGIAMLEPSLPIWMMDTMGASRWKQGATFLPASISYLIGTNLFGPLGHRMGRWLASLIGLVVIGLCLMCIPLATSINHLIIPNAGLGFAIGMVDSSMMPELGYLVDIRHSAVYGSVYAIGDVAFCLGFAIGPALSGTLVNTIGFEWMLFGIAILNFLYAPLMYFLRAPPTKEEKKSLIIGEKSSVRYVTYQNEEDD 513          
BLAST of Cotesia_rubecula011001-RA vs. genbank:protein
Match: gi|954558158|ref|XP_014602755.1| (PREDICTED: synaptic vesicular amine transporter [Polistes canadensis])

HSP 1 Score: 788.489 bits (2035), Expect = 0.000e+0
Identity = 389/487 (79.88%), Postives = 427/487 (87.68%), Query Frame = 0
Query:    3 VPIIPEFLYDIKHPNNTLSQHLDGPHYT-----------TRPMTIASIISTPIPPTKCTCPQVNASNNGQLEFLQATTGAPVSIVNGSTIMVPINTTSLEDLEKSQRHKELLEETVAVGIMFASKAFVQLLANPIVGPLTHKIGYSVPMFAGFVIMFVSTLIFAFGRSYSVLFIARALQGIGSSCSTVSGMGMLAERYQDDKERGNAMGIALGGLALGVLIGPPFGGLMYEFVGKSAPFLALSVLALGDGLLQLLMLQPTVVYTETASPSLKALVTDPYIIVAAGAITFANMGIAMLEPSLPIWMMDTMGASRWKQGATFLPASISYLIGTNLFGPLGHRMGRWLASLVGLIVIGFCLMCIPLATNINHLIMPNAGLGFAIGMVDSSMMPELGYLVDIRHTAVYGSVYAIGDVAFCLGYVVGPALSGTLVNTIGFEWMLFGTAMLCFMYAPLMYFLKSPPTKEEKKSLIIGEKSSVRYVSYENEEEE 478
            VPIIPEFLYDIKHPN+TLS+HL+G H             T P    +      P  KC+CP  N S+N QLEFL  TT     + + +TI    N T+ E  EK QRHKELLEETVAVG+MFASKAFVQLLANP+VGPLTH+IGYS+PMF GF+IMF+STLIFAFGRSY +LF+ARALQGIGSSCS+VSGMGMLAERYQDDKERGNAMGIALGGLALGVLIGPPFGG+MYEFVGKSAPFL LS LALGDGLLQLLMLQP+VVYTE   PSLK+LVTDPYII+AAGAITFANMGIAMLEPSLPIWMMDTMGASRWKQGATFLPASISYLIGTNLFGPLGHRMGRWLASL+GL+VIG CLMCIPLAT+INHLI+PNAGLGFAIGMVDSSMMPELGYLVDIRH+AVYGSVYAIGDVAFCLG+ +GPALSGTLVNTIGFEWMLFG A+L F+YAPLMYFL++PPTKEEKKSLIIGEKSSVRYV+Y+NEE++
Sbjct:   39 VPIIPEFLYDIKHPNSTLSEHLEGNHRAEVITTTTTIATTIPTMTTTTSPITPPIPKCSCPCNNTSSNSQLEFLSGTT-MSAELTDSTTI----NATTAEFKEKEQRHKELLEETVAVGMMFASKAFVQLLANPVVGPLTHRIGYSIPMFTGFIIMFISTLIFAFGRSYGILFLARALQGIGSSCSSVSGMGMLAERYQDDKERGNAMGIALGGLALGVLIGPPFGGVMYEFVGKSAPFLVLSALALGDGLLQLLMLQPSVVYTEAEPPSLKSLVTDPYIILAAGAITFANMGIAMLEPSLPIWMMDTMGASRWKQGATFLPASISYLIGTNLFGPLGHRMGRWLASLIGLVVIGLCLMCIPLATSINHLIIPNAGLGFAIGMVDSSMMPELGYLVDIRHSAVYGSVYAIGDVAFCLGFAIGPALSGTLVNTIGFEWMLFGIAILNFLYAPLMYFLRAPPTKEEKKSLIIGEKSSVRYVTYQNEEDD 520          
BLAST of Cotesia_rubecula011001-RA vs. genbank:protein
Match: gi|998518637|ref|XP_015520213.1| (PREDICTED: synaptic vesicular amine transporter [Neodiprion lecontei] >gi|998518639|ref|XP_015520214.1| PREDICTED: synaptic vesicular amine transporter [Neodiprion lecontei])

HSP 1 Score: 785.793 bits (2028), Expect = 0.000e+0
Identity = 390/475 (82.11%), Postives = 423/475 (89.05%), Query Frame = 0
Query:    3 VPIIPEFLYDIKHPNNTLSQHLDGPHYTTRPMTIASIISTPIPPTKCTCPQVNASNNGQLEFLQATTGAPVSIVNGSTIMVPINTTSLEDLEKSQRHKELLEETVAVGIMFASKAFVQLLANPIVGPLTHKIGYSVPMFAGFVIMFVSTLIFAFGRSYSVLFIARALQGIGSSCSTVSGMGMLAERYQDDKERGNAMGIALGGLALGVLIGPPFGGLMYEFVGKSAPFLALSVLALGDGLLQLLMLQPTVVYTETASPSLKALVTDPYIIVAAGAITFANMGIAMLEPSLPIWMMDTMGASRWKQGATFLPASISYLIGTNLFGPLGHRMGRWLASLVGLIVIGFCLMCIPLATNINHLIMPNAGLGFAIGMVDSSMMPELGYLVDIRHTAVYGSVYAIGDVAFCLGYVVGPALSGTLVNTIGFEWMLFGTAMLCFMYAPLMYFLKSPPTKEEKKSLIIGEKSSVRYVSYENEEE 477
            VPIIPEFLYDI+HPN TLS+HL+G        T  +  +TP P  KC CP  N SNN  LEFL  T+  P  I+   T     N TSL+D E  QRHKELLEETVAVG+MFASKAFVQLLANPIVGPLTHKIGYS+PMF GF+IMF+STLIFAFGRSYSVLF+ARALQGIGSSCS+VSGMGMLAERYQDDKERGNAMGIALGGLALGVLIGPPFGG+MYEFVGKSAPFL LS LALGDGLLQLLMLQP+VVYTE   PSLKALVTDPYII+AAGAITFANMGIAMLEPSLPIWMMDTMGASRWKQGATFLPASISYLIGTNLFGPL H+MGRWLAS++GL+VIG CLMCIPLAT I+HLI+PNAGLGFAIGMVDSSMMPELGYLVDIRH+AVYGSVYAIGDVAFCLG+ +GPALSGTLVNTIGFEWMLFG A+L F+YAPLMYFL++PPTKEEKKSLIIGEKSSVRYV+Y+NEE+
Sbjct:   40 VPIIPEFLYDIRHPNATLSEHLEG----ATQHTTTTTTTTPFPVPKCQCPN-NGSNNA-LEFL-VTSTTPADIIGNMT-----NATSLKDRENEQRHKELLEETVAVGMMFASKAFVQLLANPIVGPLTHKIGYSIPMFTGFIIMFLSTLIFAFGRSYSVLFLARALQGIGSSCSSVSGMGMLAERYQDDKERGNAMGIALGGLALGVLIGPPFGGVMYEFVGKSAPFLVLSALALGDGLLQLLMLQPSVVYTEADPPSLKALVTDPYIIIAAGAITFANMGIAMLEPSLPIWMMDTMGASRWKQGATFLPASISYLIGTNLFGPLAHKMGRWLASMIGLVVIGVCLMCIPLATKIDHLIVPNAGLGFAIGMVDSSMMPELGYLVDIRHSAVYGSVYAIGDVAFCLGFAIGPALSGTLVNTIGFEWMLFGIAILNFLYAPLMYFLRAPPTKEEKKSLIIGEKSSVRYVTYQNEED 502          
BLAST of Cotesia_rubecula011001-RA vs. genbank:protein
Match: gi|766931531|ref|XP_011497949.1| (PREDICTED: synaptic vesicular amine transporter [Ceratosolen solmsi marchali])

HSP 1 Score: 782.326 bits (2019), Expect = 0.000e+0
Identity = 383/477 (80.29%), Postives = 428/477 (89.73%), Query Frame = 0
Query:    3 VPIIPEFLYDIKHPNNTLSQHLDG-PHYTTRPMTIASIISTPIPPTKCTCPQVNASNNGQLEFLQATTGAPVSIVNGSTIMVPINTTSLEDLEKSQRHKELLEETVAVGIMFASKAFVQLLANPIVGPLTHKIGYSVPMFAGFVIMFVSTLIFAFGRSYSVLFIARALQGIGSSCSTVSGMGMLAERYQDDKERGNAMGIALGGLALGVLIGPPFGGLMYEFVGKSAPFLALSVLALGDGLLQLLMLQPTVVYTETASPSLKALVTDPYIIVAAGAITFANMGIAMLEPSLPIWMMDTMGASRWKQGATFLPASISYLIGTNLFGPLGHRMGRWLASLVGLIVIGFCLMCIPLATNINHLIMPNAGLGFAIGMVDSSMMPELGYLVDIRHTAVYGSVYAIGDVAFCLGYVVGPALSGTLVNTIGFEWMLFGTAMLCFMYAPLMYFLKSPPTKEEKKSLIIGEKSSVRYVSYENEEEE 478
            VPIIPEFLYD+KHPN+TLS+HL+G  H+T++  T     + P     C+C   NASNN  LEF+ +T    V+ +  +TI    N T +E LEK +RH+EL+EETVAVG+MFASKAFVQLLANPIVGPLTHKIGYS+PMF GF+IMF+STLIFAFGRSY +LF+ARALQGIGSSCS+VSGMGMLAERYQDDKERGNAMGIALGGLALGVLIGPPFGGLMYEFVGKSAPFL LS LALGDG+LQLLMLQP+VVYTE   PSLK+LVTDPYII+AAGAITFANMGIAMLEPSLPIWMMDTM ASRWKQGATFLPASISYLIGTNLFGPLGH+MGRWLA+L+GL+VIGFCLMCIPLA +I+HLI+PNAGLGFAIGMVDSSMMPELGYLVDIRH+AVYGSVYAIGD+AFCLG+ +GPALSGTLVNTIGFEWMLFG A+L F+YAP MYFLK+PPTKEEKKSLI+GEKSSVRYV+YENEEEE
Sbjct:   42 VPIIPEFLYDMKHPNSTLSEHLEGAEHHTSKMTTTTITPTAP----GCSCAS-NASNNSPLEFILSTA---VTSIETTTI----NQTVVEALEKKERHRELIEETVAVGMMFASKAFVQLLANPIVGPLTHKIGYSIPMFTGFIIMFLSTLIFAFGRSYGILFLARALQGIGSSCSSVSGMGMLAERYQDDKERGNAMGIALGGLALGVLIGPPFGGLMYEFVGKSAPFLVLSALALGDGVLQLLMLQPSVVYTEAEPPSLKSLVTDPYIILAAGAITFANMGIAMLEPSLPIWMMDTMSASRWKQGATFLPASISYLIGTNLFGPLGHKMGRWLAALIGLVVIGFCLMCIPLAKSIDHLIIPNAGLGFAIGMVDSSMMPELGYLVDIRHSAVYGSVYAIGDIAFCLGFAIGPALSGTLVNTIGFEWMLFGIAVLNFIYAPFMYFLKAPPTKEEKKSLIVGEKSSVRYVTYENEEEE 506          
BLAST of Cotesia_rubecula011001-RA vs. genbank:protein
Match: gi|936694620|ref|XP_014225298.1| (PREDICTED: synaptic vesicular amine transporter [Trichogramma pretiosum])

HSP 1 Score: 778.859 bits (2010), Expect = 0.000e+0
Identity = 379/476 (79.62%), Postives = 424/476 (89.08%), Query Frame = 0
Query:    3 VPIIPEFLYDIKHPNNTLSQHLDGPHYTTRPMTIASIISTPIPPTKCTCPQVNASNNGQLEFLQATTGAPVSIVNGSTIMVPINTTSLEDLEKSQRHKELLEETVAVGIMFASKAFVQLLANPIVGPLTHKIGYSVPMFAGFVIMFVSTLIFAFGRSYSVLFIARALQGIGSSCSTVSGMGMLAERYQDDKERGNAMGIALGGLALGVLIGPPFGGLMYEFVGKSAPFLALSVLALGDGLLQLLMLQPTVVYTETASPSLKALVTDPYIIVAAGAITFANMGIAMLEPSLPIWMMDTMGASRWKQGATFLPASISYLIGTNLFGPLGHRMGRWLASLVGLIVIGFCLMCIPLATNINHLIMPNAGLGFAIGMVDSSMMPELGYLVDIRHTAVYGSVYAIGDVAFCLGYVVGPALSGTLVNTIGFEWMLFGTAMLCFMYAPLMYFLKSPPTKEEKKSLIIGEKSSVRYVSYENEEEE 478
            VPIIPEFLYD+KHPN TL+  ++G  +TT   T+A     P  PT C+CPQ   SN+  LEF+Q+ T A +           +N T+LE +E+ +RHKEL+EETVAVGIMFASKA VQLLANPIVGPLTHKIGYS+PMFAGF+IMF+ST+IFAFGRSY +LF+ARALQGIGSSCS+VSGMGMLAERYQDDKERGNAMGIALGGLALGVLIGPPFGG+MYE+VGKSAPFL LS LALGDGLLQLLMLQP+V+YTE   PSLK+LVTDPYII+AAGAITFANMGIAMLEPSLPIWMMDTMGASR +QGATFLPASISYLIGTNLFGPLGHRMGRWLA+L+GL VIGFCLMCIPLAT I+HLI+PNAGLGFAIGMVDSSMMPELGYLVDIRHTAVYGSVYAIGDVAFCLG+ +GPALSGTLVN+IGFEWMLFG A+L F+YAP MYFLK+PPTKEEKK+LI+GEKSSVRYV+YENEEE+
Sbjct:   39 VPIIPEFLYDMKHPNATLNNFMEGAKHTTT--TVA-----PTSPT-CSCPQQGHSNHSALEFIQSATAASIEATT-------VNQTALELVERKERHKELVEETVAVGIMFASKAVVQLLANPIVGPLTHKIGYSIPMFAGFIIMFISTVIFAFGRSYGILFLARALQGIGSSCSSVSGMGMLAERYQDDKERGNAMGIALGGLALGVLIGPPFGGIMYEYVGKSAPFLVLSALALGDGLLQLLMLQPSVIYTEAEPPSLKSLVTDPYIILAAGAITFANMGIAMLEPSLPIWMMDTMGASRVQQGATFLPASISYLIGTNLFGPLGHRMGRWLAALIGLFVIGFCLMCIPLATRIDHLIVPNAGLGFAIGMVDSSMMPELGYLVDIRHTAVYGSVYAIGDVAFCLGFAIGPALSGTLVNSIGFEWMLFGIAILNFIYAPCMYFLKAPPTKEEKKTLIVGEKSSVRYVTYENEEED 499          
BLAST of Cotesia_rubecula011001-RA vs. genbank:protein
Match: gi|1153833682|ref|XP_020293455.1| (synaptic vesicular amine transporter [Pseudomyrmex gracilis] >gi|1153833684|ref|XP_020293456.1| synaptic vesicular amine transporter [Pseudomyrmex gracilis])

HSP 1 Score: 775.778 bits (2002), Expect = 0.000e+0
Identity = 383/480 (79.79%), Postives = 425/480 (88.54%), Query Frame = 0
Query:    3 VPIIPEFLYDIKHPNNTLSQHLDGPHYTTRPMTIASIISTPIPP----TKCTCPQVNASNNGQLEFLQATTGAPVSIVNGSTIMVPINTTSLEDLEKSQRHKELLEETVAVGIMFASKAFVQLLANPIVGPLTHKIGYSVPMFAGFVIMFVSTLIFAFGRSYSVLFIARALQGIGSSCSTVSGMGMLAERYQDDKERGNAMGIALGGLALGVLIGPPFGGLMYEFVGKSAPFLALSVLALGDGLLQLLMLQPTVVYTETASPSLKALVTDPYIIVAAGAITFANMGIAMLEPSLPIWMMDTMGASRWKQGATFLPASISYLIGTNLFGPLGHRMGRWLASLVGLIVIGFCLMCIPLATNINHLIMPNAGLGFAIGMVDSSMMPELGYLVDIRHTAVYGSVYAIGDVAFCLGYVVGPALSGTLVNTIGFEWMLFGTAMLCFMYAPLMYFLKSPPTKEEKKSLIIGEKSSVRYVSYENEEEE 478
            VPIIPEFLYDIKHPN TLS+HL+  +   R  T  SI +T +P     +KC CP  N S++ Q+EF+Q TT +         +    N T  E  EK QRH+ELLEETVAVG+MFASKAFVQLLANPIVGPLTHKIGYS+PMF GF+IMF+STLIFAFGRSY +LF+ARALQGIGSSCS+VSGMGMLAERYQDDKERGNAMGIALGGLALGVLIGPPFGG+MYEFVGKSAPFL LS LALGDGLLQLLMLQP+VVYTE   PSLK+L+TDPYI++AAGAITFANMGIAMLEPSLPIWMMDTMGASRWKQGATFLPASISYLIGTNLFGPLGH+MGRWLASL+GL+VIG CLMCIPLA +I+HLI+PNAGLGFAIGMVDSSMMPELGYLVDIRH+AVYGSVYAIGDVAFCLG+ +GPALSGTLVNTIGFEWMLFG A+L F+YAPLMYFL++PPTKEEKKSLIIGEKSSVRYV+Y+NEEE+
Sbjct:   39 VPIIPEFLYDIKHPNATLSEHLEESNTFRRTTTTISITATTVPSKTTTSKCICPP-NISDSQQIEFIQETTLS----TEPPEVTTVANLTLSETKEKEQRHRELLEETVAVGMMFASKAFVQLLANPIVGPLTHKIGYSIPMFTGFIIMFLSTLIFAFGRSYGILFLARALQGIGSSCSSVSGMGMLAERYQDDKERGNAMGIALGGLALGVLIGPPFGGVMYEFVGKSAPFLVLSALALGDGLLQLLMLQPSVVYTEAEPPSLKSLITDPYIVLAAGAITFANMGIAMLEPSLPIWMMDTMGASRWKQGATFLPASISYLIGTNLFGPLGHKMGRWLASLIGLVVIGICLMCIPLARSIDHLIVPNAGLGFAIGMVDSSMMPELGYLVDIRHSAVYGSVYAIGDVAFCLGFAIGPALSGTLVNTIGFEWMLFGIAILNFIYAPLMYFLRAPPTKEEKKSLIIGEKSSVRYVTYQNEEED 513          
BLAST of Cotesia_rubecula011001-RA vs. genbank:protein
Match: gi|817068407|ref|XP_012256139.1| (synaptic vesicular amine transporter [Athalia rosae] >gi|817068409|ref|XP_012256140.1| synaptic vesicular amine transporter [Athalia rosae])

HSP 1 Score: 775.778 bits (2002), Expect = 0.000e+0
Identity = 386/476 (81.09%), Postives = 419/476 (88.03%), Query Frame = 0
Query:    3 VPIIPEFLYDIKHPNNTLSQHLDGP-HYTTRPMTIASIISTPIPPTKCTCPQVNASNNGQLEFLQATTGAPVSIVNGSTIMVPINTTSLEDLEKSQRHKELLEETVAVGIMFASKAFVQLLANPIVGPLTHKIGYSVPMFAGFVIMFVSTLIFAFGRSYSVLFIARALQGIGSSCSTVSGMGMLAERYQDDKERGNAMGIALGGLALGVLIGPPFGGLMYEFVGKSAPFLALSVLALGDGLLQLLMLQPTVVYTETASPSLKALVTDPYIIVAAGAITFANMGIAMLEPSLPIWMMDTMGASRWKQGATFLPASISYLIGTNLFGPLGHRMGRWLASLVGLIVIGFCLMCIPLATNINHLIMPNAGLGFAIGMVDSSMMPELGYLVDIRHTAVYGSVYAIGDVAFCLGYVVGPALSGTLVNTIGFEWMLFGTAMLCFMYAPLMYFLKSPPTKEEKKSLIIGEKSSVRYVSYENEEE 477
            VPIIPEFLYDI+HPN TLS+HLDG  H+ T   T  +         KC CP  NASNN  LEFL  +T     I N +      N T  ED EK QRHKELLEETVAVG+MFASKAFVQLLANPIVGPLTHKIGYS+PMFAGF+IMF+STLIFAFGRSY +LF+ARALQGIGSSCS+VSGMGMLAERYQDDKERGNAMGIALGGLALGVLIGPPFGG+MYEFVGKSAPFL LS LALGDGLLQLLMLQP+VVYTE   PSLK LV DPYI++AAGAITFANMGIAMLEPSLPIWMMDTMGASRWKQGATFLPASISYLIGTNLFGPLGHRMGRWLASL+GL+VIG CLMCIPLA +I+HLI+PNAGLGFAIGMVDSSMMPELGYLVDIRH+AVYGSVYAIGD AFCLG+ +GPALSGTLVNTIGFEWMLFG A+L F+YAPLMYFL++PPTKEEKKSLIIG+KSSVRYV+Y+NEE+
Sbjct:   40 VPIIPEFLYDIRHPNATLSEHLDGAVHHITTTTTTTTPTPQ-----KCQCPN-NASNNA-LEFLVTSTTPADDIGNMT------NATISEDKEKQQRHKELLEETVAVGMMFASKAFVQLLANPIVGPLTHKIGYSIPMFAGFIIMFLSTLIFAFGRSYGILFLARALQGIGSSCSSVSGMGMLAERYQDDKERGNAMGIALGGLALGVLIGPPFGGVMYEFVGKSAPFLVLSALALGDGLLQLLMLQPSVVYTEADPPSLKTLVMDPYIVIAAGAITFANMGIAMLEPSLPIWMMDTMGASRWKQGATFLPASISYLIGTNLFGPLGHRMGRWLASLIGLVVIGVCLMCIPLAKSIDHLIVPNAGLGFAIGMVDSSMMPELGYLVDIRHSAVYGSVYAIGDAAFCLGFAIGPALSGTLVNTIGFEWMLFGIAILNFLYAPLMYFLRAPPTKEEKKSLIIGDKSSVRYVTYQNEED 502          
BLAST of Cotesia_rubecula011001-RA vs. genbank:protein
Match: gi|1059223039|ref|XP_017765255.1| (PREDICTED: synaptic vesicular amine transporter [Eufriesea mexicana])

HSP 1 Score: 775.007 bits (2000), Expect = 0.000e+0
Identity = 387/491 (78.82%), Postives = 427/491 (86.97%), Query Frame = 0
Query:    3 VPIIPEFLYDIKHPNNTLSQHLDGPHYTTRPMTIASIISTPIPPT-----------KCTCPQVNASNNGQLEFLQATTGAPVSI-VNG---STIMVPINTTSLEDLEKSQRHKELLEETVAVGIMFASKAFVQLLANPIVGPLTHKIGYSVPMFAGFVIMFVSTLIFAFGRSYSVLFIARALQGIGSSCSTVSGMGMLAERYQDDKERGNAMGIALGGLALGVLIGPPFGGLMYEFVGKSAPFLALSVLALGDGLLQLLMLQPTVVYTETASPSLKALVTDPYIIVAAGAITFANMGIAMLEPSLPIWMMDTMGASRWKQGATFLPASISYLIGTNLFGPLGHRMGRWLASLVGLIVIGFCLMCIPLATNINHLIMPNAGLGFAIGMVDSSMMPELGYLVDIRHTAVYGSVYAIGDVAFCLGYVVGPALSGTLVNTIGFEWMLFGTAMLCFMYAPLMYFLKSPPTKEEKKSLIIGEKSSVRYVSYENEEEE 478
            VPIIPEFLYDIKHPN TLS+HL+G    +R  T   I  T                KC C   + SN+ QLEFL ATT +P +I + G   ST +  I  +  E  EK QRH+ELL+ETVAVGIMFASKAFVQLLANPIVGPLTHKIGYS+PMF GF+IMF+STLIFAFGRSY +LF+ARALQGIGSSCS+VSGMGMLAERYQDDKERGNAMGIALGGLALGVLIGPPFGG+MYEFVGKSAPFL LS LALGDG+LQLL+LQP+VVYTE   PSLK+L+TDPYI++AAGAITFANMGIAMLEPSLPIWMMDTMGASRWKQGATFLPASISYLIGTNLFGPLGHRMGRWLASL+GL+VIG CLMCIPLA +I+HLI+PNAGLGFAIGMVDSSMMPELGYLVDIRHTAVYGSVYAIGDVAFCLG+ +GPALSGTLVN+IGFEWMLFG A+L F+YAPLMYFL++PPTKEEKKSLIIGEKSSVRYV+Y+NEEEE
Sbjct:   39 VPIIPEFLYDIKHPNATLSEHLEGGS-GSRATTFTGIQPTSSDIIASISSDVTTTPKCPCAP-SKSNDSQLEFLYATTSSPSNIEITGMLESTSVGDITNSEAEMGEKEQRHRELLQETVAVGIMFASKAFVQLLANPIVGPLTHKIGYSIPMFTGFIIMFISTLIFAFGRSYGILFLARALQGIGSSCSSVSGMGMLAERYQDDKERGNAMGIALGGLALGVLIGPPFGGVMYEFVGKSAPFLILSALALGDGILQLLVLQPSVVYTEAEPPSLKSLITDPYIVLAAGAITFANMGIAMLEPSLPIWMMDTMGASRWKQGATFLPASISYLIGTNLFGPLGHRMGRWLASLIGLVVIGICLMCIPLARSIDHLIVPNAGLGFAIGMVDSSMMPELGYLVDIRHTAVYGSVYAIGDVAFCLGFAIGPALSGTLVNSIGFEWMLFGIAILNFIYAPLMYFLRAPPTKEEKKSLIIGEKSSVRYVTYQNEEEE 527          
BLAST of Cotesia_rubecula011001-RA vs. genbank:protein
Match: gi|751225452|ref|XP_011166113.1| (PREDICTED: synaptic vesicular amine transporter [Solenopsis invicta] >gi|751225454|ref|XP_011166114.1| PREDICTED: synaptic vesicular amine transporter [Solenopsis invicta])

HSP 1 Score: 774.622 bits (1999), Expect = 0.000e+0
Identity = 386/477 (80.92%), Postives = 426/477 (89.31%), Query Frame = 0
Query:    3 VPIIPEFLYDIKHPNNTLSQHLDG-PHYTTRPMTIASIISTPIPPTKCTCPQVNASNNGQLEFLQATTGAPVSIVNGSTIMVPINTTSLEDLEKSQRHKELLEETVAVGIMFASKAFVQLLANPIVGPLTHKIGYSVPMFAGFVIMFVSTLIFAFGRSYSVLFIARALQGIGSSCSTVSGMGMLAERYQDDKERGNAMGIALGGLALGVLIGPPFGGLMYEFVGKSAPFLALSVLALGDGLLQLLMLQPTVVYTETASPSLKALVTDPYIIVAAGAITFANMGIAMLEPSLPIWMMDTMGASRWKQGATFLPASISYLIGTNLFGPLGHRMGRWLASLVGLIVIGFCLMCIPLATNINHLIMPNAGLGFAIGMVDSSMMPELGYLVDIRHTAVYGSVYAIGDVAFCLGYVVGPALSGTLVNTIGFEWMLFGTAMLCFMYAPLMYFLKSPPTKEEKKSLIIGEKSSVRYVSYENEEEE 478
            VPIIPEFLYDIKHPN TLS+HL+G  H+ T  +T  S  +T    +KCTC   N S    LEFL ATT  P+++      +   N TS E  EK QRH+ELLEETVAVG+MFASKAFVQLLANPIVGPLTHKIGYS+PMF GF+IMF+STLIFAFGRSY +LF+ARALQGIGSSCS+VSGMGMLAERYQDDKERGNAMGIALGGLALGVLIGPPFGG+MYEFVGKSAPFL LS LALGDGLLQLLMLQP+VVYTE   PSLK+L+TDPYII+AAGAITFANMGIAMLEPSLPIWMMDTMGASRWKQGATFLPASISYLIGTNLFGPLGH+MGRWLASL+GL+VIG CLMCIPLA +I+HLI+PNAGLGFAIGMVDSSMMPELGYLVDIRH+AVYGSVYAIGDVAFCLG+ +GPALSGTLVN+IGFEWMLFG A+L F+YAPLMYFL++PPTKEEKKSLIIGEKSSVRYV+Y+NEEE+
Sbjct:   39 VPIIPEFLYDIKHPNATLSEHLEGGAHHQTTVVTTTSSATTTPATSKCTCAP-NTSVASSLEFLHATT-PPMNLSE----ITAANLTSPESKEKEQRHRELLEETVAVGMMFASKAFVQLLANPIVGPLTHKIGYSIPMFTGFIIMFLSTLIFAFGRSYGILFLARALQGIGSSCSSVSGMGMLAERYQDDKERGNAMGIALGGLALGVLIGPPFGGVMYEFVGKSAPFLVLSALALGDGLLQLLMLQPSVVYTEAEPPSLKSLITDPYIILAAGAITFANMGIAMLEPSLPIWMMDTMGASRWKQGATFLPASISYLIGTNLFGPLGHKMGRWLASLIGLVVIGICLMCIPLARSIDHLIVPNAGLGFAIGMVDSSMMPELGYLVDIRHSAVYGSVYAIGDVAFCLGFAIGPALSGTLVNSIGFEWMLFGIAILNFIYAPLMYFLRAPPTKEEKKSLIIGEKSSVRYVTYQNEEED 509          
The following BLAST results are available for this feature:
BLAST of Cotesia_rubecula011001-RA vs. genbank:protein
Analysis Date: 2017-10-27 (Cotesia rubecula OGS 1.0 Blast NR)
Total hits: 20
Match NameE-valueIdentityDescription
gi|665808679|ref|XP_008552672.1|0.000e+094.13PREDICTED: synaptic vesicular amine transporter [M... [more]
gi|972198634|ref|XP_015181296.1|0.000e+081.04PREDICTED: synaptic vesicular amine transporter [P... [more]
gi|954558158|ref|XP_014602755.1|0.000e+079.88PREDICTED: synaptic vesicular amine transporter [P... [more]
gi|998518637|ref|XP_015520213.1|0.000e+082.11PREDICTED: synaptic vesicular amine transporter [N... [more]
gi|766931531|ref|XP_011497949.1|0.000e+080.29PREDICTED: synaptic vesicular amine transporter [C... [more]
gi|936694620|ref|XP_014225298.1|0.000e+079.62PREDICTED: synaptic vesicular amine transporter [T... [more]
gi|1153833682|ref|XP_020293455.1|0.000e+079.79synaptic vesicular amine transporter [Pseudomyrmex... [more]
gi|817068407|ref|XP_012256139.1|0.000e+081.09synaptic vesicular amine transporter [Athalia rosa... [more]
gi|1059223039|ref|XP_017765255.1|0.000e+078.82PREDICTED: synaptic vesicular amine transporter [E... [more]
gi|751225452|ref|XP_011166113.1|0.000e+080.92PREDICTED: synaptic vesicular amine transporter [S... [more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0055085 transmembrane transport
cellular_component GO:0016021 integral component of membrane
InterPro
Analysis Name: Cotesia rubecula OGS 1.0 InterProScan
Date Performed: 2017-10-27
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3D1.20.1250.20coord: 268..457
e-value: 1.1E-29
score: 102.6
coord: 80..251
e-value: 4.5E-37
score: 126.8
NoneNo IPR availablePANTHERPTHR24004FAMILY NOT NAMEDcoord: 3..20
NoneNo IPR availablePANTHERPTHR24004FAMILY NOT NAMEDcoord: 103..467
NoneNo IPR availablePANTHERPTHR24004:SF5GH10249Pcoord: 103..467
coord: 3..20
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 289..307
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 158..197
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 381..391
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 392..416
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 1..101
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 198..216
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 329..334
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 123..133
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 356..360
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 361..380
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 417..427
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 102..122
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 269..288
NoneNo IPR availablePHOBIUSNON_CYTOPLASMIC_DOMAINNon cytoplasmic domaincoord: 217..227
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 228..248
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 428..447
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 249..268
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 335..355
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 308..328
NoneNo IPR availablePHOBIUSCYTOPLASMIC_DOMAINCytoplasmic domaincoord: 448..478
NoneNo IPR availablePHOBIUSTRANSMEMBRANETransmembrane regioncoord: 134..157
NoneNo IPR availableTMHMMTMhelixcoord: 307..329
NoneNo IPR availableTMHMMTMhelixcoord: 135..157
NoneNo IPR availableTMHMMTMhelixcoord: 428..447
NoneNo IPR availableTMHMMTMhelixcoord: 394..413
NoneNo IPR availableTMHMMTMhelixcoord: 368..387
NoneNo IPR availableTMHMMTMhelixcoord: 230..252
NoneNo IPR availableTMHMMTMhelixcoord: 265..287
NoneNo IPR availableTMHMMTMhelixcoord: 336..358
NoneNo IPR availableTMHMMTMhelixcoord: 198..220
IPR011701Major facilitator superfamilyPFAMPF07690MFS_1coord: 108..381
e-value: 1.3E-34
score: 119.3
IPR020846Major facilitator superfamily domainPROSITEPS50850MFScoord: 63..453
score: 18.247
IPR020846Major facilitator superfamily domainSUPERFAMILY103473MFS general substrate transportercoord: 107..453

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_5474contigscaffold_5474:7591..10893 -    View in Apollo
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Cotesia rubecula - OGS 1.02017-09-01
Cotesia rubecula OGS 1.0 Blast2GO2017-10-27
Cotesia rubecula OGS 1.0 Blast NR2017-10-27
Cotesia rubecula OGS 1.0 InterProScan2017-10-27
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
Cotesia_rubecula011001-RACotesia_rubecula011001-RACotesia rubeculamRNAscaffold_5474 7538..10893 -


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Cotesia_rubecula011001-PA ID=Cotesia_rubecula011001-PA|Name=Cotesia_rubecula011001-RA|organism=Cotesia rubecula|type=polypeptide|length=479bp
MKVPIIPEFLYDIKHPNNTLSQHLDGPHYTTRPMTIASIISTPIPPTKCT
CPQVNASNNGQLEFLQATTGAPVSIVNGSTIMVPINTTSLEDLEKSQRHK
ELLEETVAVGIMFASKAFVQLLANPIVGPLTHKIGYSVPMFAGFVIMFVS
TLIFAFGRSYSVLFIARALQGIGSSCSTVSGMGMLAERYQDDKERGNAMG
IALGGLALGVLIGPPFGGLMYEFVGKSAPFLALSVLALGDGLLQLLMLQP
TVVYTETASPSLKALVTDPYIIVAAGAITFANMGIAMLEPSLPIWMMDTM
GASRWKQGATFLPASISYLIGTNLFGPLGHRMGRWLASLVGLIVIGFCLM
CIPLATNINHLIMPNAGLGFAIGMVDSSMMPELGYLVDIRHTAVYGSVYA
IGDVAFCLGYVVGPALSGTLVNTIGFEWMLFGTAMLCFMYAPLMYFLKSP
PTKEEKKSLIIGEKSSVRYVSYENEEEE.
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0055085transmembrane transport
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: INTERPRO
TermDefinition
IPR011701MFS
IPR020846MFS_dom