Cotesia_rubecula014417-PA (polypeptide) Cotesia rubecula
Overview
Homology
BLAST of Cotesia_rubecula014417-RA vs. genbank:protein
Match: gi|1070161197|ref|XP_018360353.1| (PREDICTED: uncharacterized protein LOC108759411, partial [Trachymyrmex cornetzi]) HSP 1 Score: 62.003 bits (149), Expect = 7.501e-9 Identity = 40/95 (42.11%), Postives = 55/95 (57.89%), Query Frame = 0 Query: 18 ELVGFVDAIEATTRYG----SKLAFKFVVNNGDGVRVQVSAWNDEVTRAEQNIHIDHIVHIDYAWAVV--SSPFNRSDYFGAELTIQTYTSIQDL 106 E++G+V++IEA+ S FKF +NNG G ++QV AWNDEV R EQ + + IVH+D A A + FN+ + EL IQ T I L Sbjct: 1 EIIGYVESIEASRTICKDNESYRLFKFFINNGTGKKIQVVAWNDEVDRIEQLVRTNSIVHLDGAQARKPRNEKFNQGN-VEFELLIQRGTVITTL 94 The following BLAST results are available for this feature:
BLAST of Cotesia_rubecula014417-RA vs. genbank:protein
Analysis Date: 2017-10-27 (Cotesia rubecula OGS 1.0 Blast NR) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Cotesia_rubecula014417-PA ID=Cotesia_rubecula014417-PA|Name=Cotesia_rubecula014417-RA|organism=Cotesia rubecula|type=polypeptide|length=151bpback to top |