rna318 (mRNA) Diuraphis noxia

You are viewing an mRNA, more information available on the corresponding polypeptide page

Overview
NameXM_015507621.1
Unique Namerna318
TypemRNA
OrganismDiuraphis noxia (Russian wheat aphid)
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
JOTR01000004contigJOTR01000004:467216..467991 -
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Diuraphis noxia NCBI Gnomon annotation (20160302)2016-03-02
Properties
Property NameValue
Transcript idXM_015507621.1
ProductS-phase kinase-associated protein 1
Model evidenceSupporting evidence includes similarity to: 28 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments
GeneLOC107161275
GbkeymRNA
Cross References
External references for this mRNA
DatabaseAccession
GenbankXM_015507621.1
GeneID107161275
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesTypePosition
LOC107161275gene219Diuraphis noxiageneJOTR01000004 467216..467991 -


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesTypePosition
XM_015507621.1rna318Diuraphis noxiapolypeptideJOTR01000004 467399..467887 -


The following CDS feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
XP_015363107.1cds315Diuraphis noxiaCDSJOTR01000004 467399..467887 -


The following exon feature(s) are a part of this mRNA:

Feature NameUnique NameSpeciesTypePosition
id2791id2791Diuraphis noxiaexonJOTR01000004 467216..467991 -


Sequences
The following sequences are available for this feature:

protein sequence of XM_015507621.1

>rna318 ID=rna318|Name=XM_015507621.1|organism=Diuraphis noxia|type=polypeptide|length=163bp
MPMIKLQSSDGEVFQVDFEIAKASVTIKTMVEDLGLEEEDEEIVPLPNVN
AGILKKVIQWATYHKDDPPPAEDDEGREKRTDDISSWDADFLKVDQGTLF
ELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTAAEED
QVRKENEWCEEK.
back to top

mRNA from alignment at JOTR01000004:467216..467991-

Legend: exonCDSpolypeptide
Hold the cursor over a type above to highlight its positions in the sequence below.
>rna318 ID=rna318|Name=XM_015507621.1|organism=Diuraphis noxia|type=mRNA|length=776bp|location=Sequence derived from alignment at JOTR01000004:467216..467991- (Diuraphis noxia)
CTAATCTACTATACATTCATTATTCATTATTCATTACATTCTCGACTGAG TCGTCTGCATTTTCTCCCGTTGATTCACGGCTTCACGCATCACACCAATA CAAGATGCCTATGATAAAGCTGCAGAGTTCGGATGGCGAAGTGTTTCAAG TAGACTTCGAGATCGCCAAAGCTTCGGTGACTATAAAAACTATGGTGGAA GATTTGGGCTTGGAAGAGGAAGATGAGGAGATCGTCCCGTTGCCAAATGT AAATGCCGGTATATTGAAAAAAGTCATCCAGTGGGCAACCTACCACAAAG ACGACCCACCACCAGCCGAAGATGACGAAGGGCGTGAAAAGCGCACTGAC GATATATCCAGCTGGGATGCGGATTTCTTGAAGGTAGATCAGGGTACTCT GTTTGAACTCATACTGGCCGCCAACTATTTAGATATCAAAGGCTTGTTAG ATGTCACTTGCAAGACGGTCGCCAATATGATTAAGGGCAAAACACCGGAG GAAATAAGGAAAACTTTCAACATCAAAAATGATTTCACTGCTGCAGAGGA GGACCAAGTACGTAAAGAGAATGAATGGTGCGAGGAGAAGTAATTGATTT TTGTCTACAGATGTATGTACTTTTTTTTTTGTCAACAGCATAATTTTAAT TTTTCATTCAATAATAAACCTGTTTTGTATTTATTTACTTTTTGTAATAG GAATTTTGTTTTAGTCGAGGTTTTAGTTTGTATCTTAATATAAGGACAAT TTGGATTAAAACATTTGTACATTTTA
back to top

Coding sequence (CDS) from alignment at JOTR01000004:467216..467991-

>rna318 ID=rna318|Name=XM_015507621.1|organism=Diuraphis noxia|type=CDS|length=489bp|location=Sequence derived from alignment at JOTR01000004:467216..467991- (Diuraphis noxia)
ATGCCTATGATAAAGCTGCAGAGTTCGGATGGCGAAGTGTTTCAAGTAGA
CTTCGAGATCGCCAAAGCTTCGGTGACTATAAAAACTATGGTGGAAGATT
TGGGCTTGGAAGAGGAAGATGAGGAGATCGTCCCGTTGCCAAATGTAAAT
GCCGGTATATTGAAAAAAGTCATCCAGTGGGCAACCTACCACAAAGACGA
CCCACCACCAGCCGAAGATGACGAAGGGCGTGAAAAGCGCACTGACGATA
TATCCAGCTGGGATGCGGATTTCTTGAAGGTAGATCAGGGTACTCTGTTT
GAACTCATACTGGCCGCCAACTATTTAGATATCAAAGGCTTGTTAGATGT
CACTTGCAAGACGGTCGCCAATATGATTAAGGGCAAAACACCGGAGGAAA
TAAGGAAAACTTTCAACATCAAAAATGATTTCACTGCTGCAGAGGAGGAC
CAAGTACGTAAAGAGAATGAATGGTGCGAGGAGAAGTAA
back to top